Dpf3 Antibody - N-terminal region (ARP38943_P050)

Catalog No: ARP38943_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

WB Suggested Anti-Dpf3 Antibody
Titration: 1.0 ug/ml
Positive Control: Mouse Spleen

Rabbit Anti-Dpf3 Antibody
Catalog Number: ARP38943_P050
Formalin Fixed Paraffin Embedded Tissue: Human Adult heart
Observed Staining: Nuclear (not in cardiomyocytes but in fibrocytes in endomysium
Primary Antibody Concentration: 1:600
Secondary Antibody: Donkey anti-Rabbit-Cy2/3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 – 2.0 sec
Protocol located in Reviews and Data.

Product Info

• Tested Species Reactivity: Mouse
• Predicted Species Reactivity: Human, Mouse, Rat, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB, IHC
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
• Peptide Sequence: Synthetic peptide located within the following region: IHNPLKALGDQFYKEAIEHCRSYNSRLCAERSVRLPFLDSQTGVAQNNCY
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-Dpf3 (ARP38943_P050) antibody is Catalog # AAP38943 (Previous Catalog # AAPY00752)

Target Info

• Gene Symbol: Dpf3
• Gene Full Name: D4, zinc and double PHD fingers, family 3
• Alias Symbols: CERD, CERD4, cer-d, BAF45C, C78788, cer-d4, Gm18872, 2810403B03Rik, 6530402L11Rik
• NCBI Gene Id: 70127
• Protein Name: Zinc finger protein DPF3
• Description of Target: Dpf3 is a muscle-specific component of the BAF complex, a multiprotein complex involved in transcriptional activation and repression of select genes by chromatin remodeling (alteration of DNA-nucleosome topology). Dpf3 specifically binds acetylated lysines on histone 3 and 4 (H3K14ac, H3K9ac, H4K5ac, H4K8ac, H4K12ac, H4K16ac). In the complex, it acts as a tissue-specific anchor between histone acetylations and methylations and chromatin remodeling. It thereby probably plays an essential role in heart and skeletal muscle development. Belongs to the neuron-specific chromatin remodeling complex (nBAF complex). During neural development a switch from a stem/progenitor to a post-mitotic chromatin remodeling mechanism occurs as neurons exit the cell cycle and become committed to their adult state. The transition from proliferating neural stem/progenitor cells to post-mitotic neurons requires a switch in subunit composition of the npBAF and nBAF complexes. As neural progenitors exit mitosis and differentiate into neurons, npBAF complexes which contain ACTL6A/BAF53A and PHF10/BAF45A, are exchanged for homologous alternative ACTL6B/BAF53B and DPF1/BAF45B or DPF3/BAF45C subunits in neuron-specific complexes (nBAF). The npBAF complex is essential for the self-renewal/proliferative capacity of the multipotent neural stem cells. The nBAF complex along with CREST plays a role regulating the activity of genes essential for dendrite growth.
• Uniprot ID: P58269-3
• Protein Accession #: NP_478119
• Nucleotide Accession #: NM_058212
• Protein Size (# AA): 356
• Molecular Weight: 40kDa