SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP33221_P050-Biotin
Size:100ul
Price: $434.00
SKU
ARP33221_P050-Biotin
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-DPF2 (ARP33221_P050-Biotin) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationBiotin
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human DPF2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: GKRYKNRPGLSYHYAHSHLAEEEGEDKEDSQPPTPVSQRSEEQKSKKGPD
Concentration0.5 mg/ml
Blocking PeptideFor anti-DPF2 (ARP33221_P050-Biotin) antibody is Catalog # AAP33221 (Previous Catalog # AAPP04258)
ReferenceOlsen,J.V., (2006) Cell 127 (3), 635-648
Publications

Middeljans, E. et al. SS18 together with animal-specific factors defines human BAF-type SWI/SNF complexes. PLoS One 7, e33834 (2012). IP, Goat, Bovine, Rat, Dog, Pig, Horse, Rabbit, Guinea pig, Human, Mouse 22442726

Gene SymbolDPF2
Gene Full NameD4, zinc and double PHD fingers family 2
Alias SymbolsREQ, CSS7, UBID4, ubi-d4
NCBI Gene Id5977
Protein NameZinc finger protein ubi-d4
Description of TargetDPF2 may be a transcription factor required for the apoptosis response following survival factor withdrawal from myeloid cells. DPF2 might also have a role in the development and maturation of lymphoid cells.
Uniprot IDQ92785
Protein Accession #NP_006259
Nucleotide Accession #NM_006268
Protein Size (# AA)391
Molecular Weight44kDa
Protein InteractionsLNX1; LDOC1; UBC; RNF2; BMI1; UPF2; YAP1; HIST3H3; EPAS1; ZNF212; TP53BP1; FHL2; NCSTN; DDX18; COPS5; CUL3; SMARCC1; SMARCA4; SMARCA2; RELA; NFKB1; SUMO2; SMARCE1; SMARCD1; SMARCC2; Bcl7b; HIST1H3A; ARID1A; HDAC1; ESRRG; ESRRB; ESRRA; REL; NFKB2; SMARCB1;
  1. What is the species homology for "DPF2 Antibody - middle region : Biotin (ARP33221_P050-Biotin)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "DPF2 Antibody - middle region : Biotin (ARP33221_P050-Biotin)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "DPF2 Antibody - middle region : Biotin (ARP33221_P050-Biotin)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "DPF2 Antibody - middle region : Biotin (ARP33221_P050-Biotin)"?

    This target may also be called "REQ, CSS7, UBID4, ubi-d4" in publications.

  5. What is the shipping cost for "DPF2 Antibody - middle region : Biotin (ARP33221_P050-Biotin)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "DPF2 Antibody - middle region : Biotin (ARP33221_P050-Biotin)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "DPF2 Antibody - middle region : Biotin (ARP33221_P050-Biotin)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "44kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "DPF2 Antibody - middle region : Biotin (ARP33221_P050-Biotin)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "DPF2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "DPF2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "DPF2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "DPF2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "DPF2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "DPF2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:DPF2 Antibody - middle region : Biotin (ARP33221_P050-Biotin)
Your Rating
We found other products you might like!