Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP33221_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP33221_P050-FITC Conjugated

ARP33221_P050-HRP Conjugated

ARP33221_P050-Biotin Conjugated

DPF2 Antibody - middle region (ARP33221_P050)

Catalog#: ARP33221_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-101106 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human DPF2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%
Complete computational species homology dataAnti-DPF2 (ARP33221_P050)
Peptide SequenceSynthetic peptide located within the following region: GKRYKNRPGLSYHYAHSHLAEEEGEDKEDSQPPTPVSQRSEEQKSKKGPD
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-DPF2 (ARP33221_P050) antibody is Catalog # AAP33221 (Previous Catalog # AAPP04258)
Datasheets/ManualsPrintable datasheet for anti-DPF2 (ARP33221_P050) antibody
Target ReferenceOlsen,J.V., (2006) Cell 127 (3), 635-648
Publications

Middeljans, E. et al. SS18 together with animal-specific factors defines human BAF-type SWI/SNF complexes. PLoS One 7, e33834 (2012). WB, Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 22442726

Gene SymbolDPF2
Official Gene Full NameD4, zinc and double PHD fingers family 2
Alias SymbolsMGC10180, REQ, UBID4, ubi-d4
NCBI Gene Id5977
Protein NameZinc finger protein ubi-d4
Description of TargetDPF2 may be a transcription factor required for the apoptosis response following survival factor withdrawal from myeloid cells. DPF2 might also have a role in the development and maturation of lymphoid cells.
Swissprot IdQ92785
Protein Accession #NP_006259
Nucleotide Accession #NM_006268
Protein Size (# AA)391
Molecular Weight44kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express DPF2.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express DPF2.
Protein InteractionsLNX1; LDOC1; UBC; RNF2; BMI1; UPF2; YAP1; HIST3H3; EPAS1; ZNF212; TP53BP1; FHL2; NCSTN; DDX18; COPS5; CUL3; SMARCC1; SMARCA4; SMARCA2; RELA; NFKB1; SUMO2; SMARCE1; SMARCD1; SMARCC2; Bcl7b; HIST1H3A; ARID1A; HDAC1; ESRRG; ESRRB; ESRRA; REL; NFKB2; SMARCB1;
Write Your Own Review
You're reviewing:DPF2 Antibody - middle region (ARP33221_P050)
Your Rating
Aviva Validation Data
Assay Development
Free Microscope
Aviva Travel Grant