Search Antibody, Protein, and ELISA Kit Solutions

DPF2 antibody - middle region (ARP33221_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP33221_P050-FITC Conjugated

ARP33221_P050-HRP Conjugated

ARP33221_P050-Biotin Conjugated

Gene Symbol:
DPF2
NCBI Gene Id:
5977
Official Gene Full Name:
D4, zinc and double PHD fingers family 2
Protein Name:
Zinc finger protein ubi-d4
Swissprot Id:
Q92785
Protein Accession #:
NP_006259
Nucleotide Accession #:
NM_006268
Alias Symbols:
MGC10180, REQ, UBID4, ubi-d4
Replacement Item:
This antibody may replace item sc-101106 from Santa Cruz Biotechnology.
Description of Target:
DPF2 may be a transcription factor required for the apoptosis response following survival factor withdrawal from myeloid cells. DPF2 might also have a role in the development and maturation of lymphoid cells.
Protein Size (# AA):
391
Molecular Weight:
44kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express DPF2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express DPF2.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human DPF2
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-DPF2 (ARP33221_P050)
Peptide Sequence:
Synthetic peptide located within the following region: GKRYKNRPGLSYHYAHSHLAEEEGEDKEDSQPPTPVSQRSEEQKSKKGPD
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
LNX1; LDOC1; UBC; RNF2; BMI1; UPF2; YAP1; HIST3H3; EPAS1; ZNF212; TP53BP1; FHL2; NCSTN; DDX18; COPS5; CUL3; SMARCC1; SMARCA4; SMARCA2; RELA; NFKB1; SUMO2; SMARCE1; SMARCD1; SMARCC2; Bcl7b; HIST1H3A; ARID1A; HDAC1; ESRRG; ESRRB; ESRRA; REL; NFKB2; SMARCB1;
Blocking Peptide:
For anti-DPF2 (ARP33221_P050) antibody is Catalog # AAP33221 (Previous Catalog # AAPP04258)
Datasheets/Manuals:
Printable datasheet for anti-DPF2 (ARP33221_P050) antibody
Target Reference:
Olsen,J.V., (2006) Cell 127 (3), 635-648
Publications:

Middeljans, E. et al. SS18 together with animal-specific factors defines human BAF-type SWI/SNF complexes. PLoS One 7, e33834 (2012). WB, Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 22442726

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...