Search Antibody, Protein, and ELISA Kit Solutions

DPF2 Antibody - middle region (ARP33221_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP33221_P050-FITC Conjugated

ARP33221_P050-HRP Conjugated

ARP33221_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-101106 from Santa Cruz Biotechnology.
The immunogen is a synthetic peptide directed towards the middle region of human DPF2
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-DPF2 (ARP33221_P050)
Peptide Sequence:
Synthetic peptide located within the following region: GKRYKNRPGLSYHYAHSHLAEEEGEDKEDSQPPTPVSQRSEEQKSKKGPD
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-DPF2 (ARP33221_P050) antibody is Catalog # AAP33221 (Previous Catalog # AAPP04258)
Printable datasheet for anti-DPF2 (ARP33221_P050) antibody
Target Reference:
Olsen,J.V., (2006) Cell 127 (3), 635-648

Middeljans, E. et al. SS18 together with animal-specific factors defines human BAF-type SWI/SNF complexes. PLoS One 7, e33834 (2012). WB, Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 22442726

Gene Symbol:
Official Gene Full Name:
D4, zinc and double PHD fingers family 2
Alias Symbols:
MGC10180, REQ, UBID4, ubi-d4
NCBI Gene Id:
Protein Name:
Zinc finger protein ubi-d4
Description of Target:
DPF2 may be a transcription factor required for the apoptosis response following survival factor withdrawal from myeloid cells. DPF2 might also have a role in the development and maturation of lymphoid cells.
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Size (# AA):
Molecular Weight:
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express DPF2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express DPF2.
Protein Interactions:

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...