- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
| Datasheets/Manuals | Printable datasheet for Doublecortin Antibody (Phospho-Ser339) (OAAF07838) |
|---|
| Predicted Species Reactivity | Human|Mouse|Rat |
|---|---|
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | Enzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry|Immunohistochemistry-Paraffin |
| Additional Information | Modification Sites: Human:S339 Mouse:S339 Rat:S339 |
| Reconstitution and Storage | -20°C |
| Immunogen | The antiserum was produced against synthesized peptide derived from human Doublecortin around the phosphorylation site of Ser376. |
| Purification | The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide. |
| Peptide Sequence | Synthetic peptide located within the following region: SLDENECRVMKGNPSATAGPKASPTPQKTSAKSPGPMRRSKSPADSANGT |
| Concentration | 1mg/ml |
| Specificity | Doublecortin (Phospho-Ser339) Antibody detects endogenous levels of Doublecortin only when phosphorylated at Ser339. |
| Formulation | Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. |
| Application Info | IHC: 1:50~1:100 ELISA: 1:1000 |
| Gene Symbol | DCX |
|---|---|
| Gene Full Name | doublecortin |
| Alias Symbols | DBCN;DC;doublecortex;doublin;lissencephalin-X;lis-X;LISX;neuronal migration protein doublecortin;SCLH;XLIS. |
| NCBI Gene Id | 1641 |
| Protein Name | Neuronal migration protein doublecortin |
| Description of Target | Microtubule-associated protein required for initial steps of neuronal dispersion and cortex lamination during cerebral cortex development. May act by competing with the putative neuronal protein kinase DCLK1 in binding to a target protein. May in that way participate in a signaling pathway that is crucial for neuronal interaction before and during migration, possibly as part of a calcium ion-dependent signal transduction pathway. May be part with PAFAH1B1/LIS-1 of overlapping, but distinct, signaling pathways that promote neuronal migration. |
| Uniprot ID | O43602 |
| Molecular Weight | 44 kDa |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "Doublecortin Antibody (Phospho-Ser339) (OAAF07838)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human|Mouse|Rat".
-
How long will it take to receive "Doublecortin Antibody (Phospho-Ser339) (OAAF07838)"?
This item is available "Domestic: within 1-2 week delivery | International: 1-2 weeks".
-
What buffer format is "Doublecortin Antibody (Phospho-Ser339) (OAAF07838)" provided in?
This item is provided in "".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "Doublecortin Antibody (Phospho-Ser339) (OAAF07838)"?
This target may also be called "DBCN;DC;doublecortex;doublin;lissencephalin-X;lis-X;LISX;neuronal migration protein doublecortin;SCLH;XLIS." in publications.
-
What is the shipping cost for "Doublecortin Antibody (Phospho-Ser339) (OAAF07838)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "Doublecortin Antibody (Phospho-Ser339) (OAAF07838)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "Doublecortin Antibody (Phospho-Ser339) (OAAF07838)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "44 kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "Doublecortin Antibody (Phospho-Ser339) (OAAF07838)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "DCX"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "DCX"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "DCX"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "DCX"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "DCX"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "DCX"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.
