Search Antibody, Protein, and ELISA Kit Solutions

DONSON antibody - middle region (ARP45862_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP45862_P050-FITC Conjugated

ARP45862_P050-HRP Conjugated

ARP45862_P050-Biotin Conjugated

Gene Symbol:
DONSON
NCBI Gene Id:
29980
Official Gene Full Name:
Downstream neighbor of SON
Protein Name:
Protein downstream neighbor of Son
Swissprot Id:
Q9NYP3
Protein Accession #:
NP_060083
Nucleotide Accession #:
NM_017613
Alias Symbols:
B17, C21orf60, DKFZP434M035, C2TA
Replacement Item:
This antibody may replace item sc-83240 from Santa Cruz Biotechnology.
Description of Target:
This gene lies downstream of the SON gene and spans 10 kb on chromosome 21. The function of this gene is unknown.This gene lies downstream of the SON gene and spans 10 kb on chromosome 21. The function of this gene is unknown.
Protein Size (# AA):
566
Molecular Weight:
63kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express DONSON.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express DONSON.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human DONSON
Tested Species Reactivity:
Human, Mouse
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-DONSON (ARP45862_P050)
Peptide Sequence:
Synthetic peptide located within the following region: DLITALISPTTRGLREAMRNEGIEFSLPLIKESGHKKETASGTSLGYGEE
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; PSMA3;
Blocking Peptide:
For anti-DONSON (ARP45862_P050) antibody is Catalog # AAP45862 (Previous Catalog # AAPP26790)
Datasheets/Manuals:
Printable datasheet for anti-DONSON (ARP45862_P050) antibody
Sample Type Confirmation:

DONSON is supported by BioGPS gene expression data to be expressed in HepG2

Target Reference:
Gardiner,K., (2002) Genomics 79 (6), 833-843
Publications:

Spellman, C., Ahmed, M. M., Dubach, D. & Gardiner, K. J. Expression of trisomic proteins in Down syndrome model systems. Gene 512, 219-225 (2013). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 23103828

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...