Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP45862_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP45862_P050-FITC Conjugated

ARP45862_P050-HRP Conjugated

ARP45862_P050-Biotin Conjugated

DONSON Antibody - middle region (ARP45862_P050)

Catalog#: ARP45862_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species ReactivityHuman, Mouse
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-83240 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human DONSON
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology dataAnti-DONSON (ARP45862_P050)
Peptide SequenceSynthetic peptide located within the following region: DLITALISPTTRGLREAMRNEGIEFSLPLIKESGHKKETASGTSLGYGEE
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-DONSON (ARP45862_P050) antibody is Catalog # AAP45862 (Previous Catalog # AAPP26790)
Datasheets/ManualsPrintable datasheet for anti-DONSON (ARP45862_P050) antibody
Sample Type Confirmation

DONSON is supported by BioGPS gene expression data to be expressed in HepG2

Target ReferenceGardiner,K., (2002) Genomics 79 (6), 833-843
Publications

Spellman, C., Ahmed, M. M., Dubach, D. & Gardiner, K. J. Expression of trisomic proteins in Down syndrome model systems. Gene 512, 219-225 (2013). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 23103828

Gene SymbolDONSON
Official Gene Full NameDownstream neighbor of SON
Alias SymbolsB17, C21orf60, DKFZP434M035, C2TA
NCBI Gene Id29980
Protein NameProtein downstream neighbor of Son
Description of TargetThis gene lies downstream of the SON gene and spans 10 kb on chromosome 21. The function of this gene is unknown.This gene lies downstream of the SON gene and spans 10 kb on chromosome 21. The function of this gene is unknown.
Swissprot IdQ9NYP3
Protein Accession #NP_060083
Nucleotide Accession #NM_017613
Protein Size (# AA)566
Molecular Weight63kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express DONSON.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express DONSON.
Protein InteractionsUBC; PSMA3;
Write Your Own Review
You're reviewing:DONSON Antibody - middle region (ARP45862_P050)
Your Rating
Aviva Travel Grant
Aviva Tissue Tool
Aviva HIS tag Deal
Assay Development