Search Antibody, Protein, and ELISA Kit Solutions

DONSON Antibody - middle region (ARP45862_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP45862_P050-FITC Conjugated

ARP45862_P050-HRP Conjugated

ARP45862_P050-Biotin Conjugated

Tested Species Reactivity:
Human, Mouse
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-83240 from Santa Cruz Biotechnology.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human DONSON
Purification:
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-DONSON (ARP45862_P050)
Peptide Sequence:
Synthetic peptide located within the following region: DLITALISPTTRGLREAMRNEGIEFSLPLIKESGHKKETASGTSLGYGEE
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-DONSON (ARP45862_P050) antibody is Catalog # AAP45862 (Previous Catalog # AAPP26790)
Datasheets/Manuals:
Printable datasheet for anti-DONSON (ARP45862_P050) antibody
Sample Type Confirmation:

DONSON is supported by BioGPS gene expression data to be expressed in HepG2

Target Reference:
Gardiner,K., (2002) Genomics 79 (6), 833-843
Publications:

Spellman, C., Ahmed, M. M., Dubach, D. & Gardiner, K. J. Expression of trisomic proteins in Down syndrome model systems. Gene 512, 219-225 (2013). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 23103828

Gene Symbol:
DONSON
Official Gene Full Name:
Downstream neighbor of SON
Alias Symbols:
B17, C21orf60, DKFZP434M035, C2TA
NCBI Gene Id:
29980
Protein Name:
Protein downstream neighbor of Son
Description of Target:
This gene lies downstream of the SON gene and spans 10 kb on chromosome 21. The function of this gene is unknown.This gene lies downstream of the SON gene and spans 10 kb on chromosome 21. The function of this gene is unknown.
Swissprot Id:
Q9NYP3
Protein Accession #:
NP_060083
Nucleotide Accession #:
NM_017613
Protein Size (# AA):
566
Molecular Weight:
63kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express DONSON.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express DONSON.
Protein Interactions:
UBC; PSMA3;

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...