Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP45862_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP45862_P050-FITC Conjugated

ARP45862_P050-HRP Conjugated

ARP45862_P050-Biotin Conjugated

DONSON Antibody - middle region (ARP45862_P050)

Catalog#: ARP45862_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human, Mouse
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-83240 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human DONSON
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data Anti-DONSON (ARP45862_P050)
Peptide Sequence Synthetic peptide located within the following region: DLITALISPTTRGLREAMRNEGIEFSLPLIKESGHKKETASGTSLGYGEE
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-DONSON (ARP45862_P050) antibody is Catalog # AAP45862 (Previous Catalog # AAPP26790)
Datasheets/Manuals Printable datasheet for anti-DONSON (ARP45862_P050) antibody
Sample Type Confirmation

DONSON is supported by BioGPS gene expression data to be expressed in HepG2

Target Reference Gardiner,K., (2002) Genomics 79 (6), 833-843
Publications

Spellman, C., Ahmed, M. M., Dubach, D. & Gardiner, K. J. Expression of trisomic proteins in Down syndrome model systems. Gene 512, 219-225 (2013). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 23103828

Gene Symbol DONSON
Official Gene Full Name Downstream neighbor of SON
Alias Symbols B17, C21orf60, DKFZP434M035, C2TA
NCBI Gene Id 29980
Protein Name Protein downstream neighbor of Son
Description of Target This gene lies downstream of the SON gene and spans 10 kb on chromosome 21. The function of this gene is unknown.This gene lies downstream of the SON gene and spans 10 kb on chromosome 21. The function of this gene is unknown.
Swissprot Id Q9NYP3
Protein Accession # NP_060083
Nucleotide Accession # NM_017613
Protein Size (# AA) 566
Molecular Weight 63kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express DONSON.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express DONSON.
Protein Interactions UBC; PSMA3;
  1. What is the species homology for "DONSON Antibody - middle region (ARP45862_P050)"?

    The tested species reactivity for this item is "Human, Mouse". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat".

  2. How long will it take to receive "DONSON Antibody - middle region (ARP45862_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "DONSON Antibody - middle region (ARP45862_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "DONSON Antibody - middle region (ARP45862_P050)"?

    This target may also be called "B17, C21orf60, DKFZP434M035, C2TA" in publications.

  5. What is the shipping cost for "DONSON Antibody - middle region (ARP45862_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "DONSON Antibody - middle region (ARP45862_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "DONSON Antibody - middle region (ARP45862_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "63kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "DONSON Antibody - middle region (ARP45862_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "DONSON"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "DONSON"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "DONSON"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "DONSON"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "DONSON"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "DONSON"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:DONSON Antibody - middle region (ARP45862_P050)
Your Rating
We found other products you might like!