DONSON Antibody - middle region (ARP45862_P050)

Catalog No: ARP45862_P050

WB Suggested Anti-DONSON Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysateDONSON is supported by BioGPS gene expression data to be expressed in HepG2

DONSON antibody - middle region (ARP45862_P050) validated by WB using Mouse brains at 1:1000.

Product Info

• Tested Species Reactivity: Human, Mouse
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human DONSON
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: DLITALISPTTRGLREAMRNEGIEFSLPLIKESGHKKETASGTSLGYGEE
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-DONSON (ARP45862_P050) antibody is Catalog # AAP45862 (Previous Catalog # AAPP26790)
• Sample Type Confirmation:

  DONSON is supported by BioGPS gene expression data to be expressed in HepG2

• Reference: Gardiner,K., (2002) Genomics 79 (6), 833-843
• Publications:

  Spellman, C., Ahmed, M. M., Dubach, D. & Gardiner, K. J. Expression of trisomic proteins in Down syndrome model systems. Gene 512, 219-225 (2013). 23103828

  The GABAAα5-selective Modulator, RO4938581, Rescues Protein Anomalies in the Ts65Dn Mouse Model of Down Syndrome. Neuroscience. 372, 192-212 (2018) 29292072

Target Info

• Gene Symbol: DONSON
• Gene Full Name: Downstream neighbor of SON
• Alias Symbols: B17, MIMIS, MISSLA, C21orf60
• NCBI Gene Id: 29980
• Protein Name: Protein downstream neighbor of Son
• Description of Target: This gene lies downstream of the SON gene and spans 10 kb on chromosome 21. The function of this gene is unknown.This gene lies downstream of the SON gene and spans 10 kb on chromosome 21. The function of this gene is unknown.
• Uniprot ID: Q9NYP3
• Protein Accession #: NP_060083
• Nucleotide Accession #: NM_017613
• Protein Size (# AA): 566
• Molecular Weight: 63kDa
• Protein Interactions: UBC; PSMA3;