Search Antibody, Protein, and ELISA Kit Solutions

DNTTIP2 Antibody - C-terminal region (ARP78708_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Gene Symbol:
DNTTIP2
Official Gene Full Name:
deoxynucleotidyltransferase, terminal, interacting protein 2
NCBI Gene Id:
30836
Protein Name:
deoxynucleotidyltransferase terminal-interacting protein 2
Swissprot Id:
Q5QJE6
Protein Accession #:
NP_055412.2
Nucleotide Accession #:
NM_014597.4
Alias Symbols:
ERBP, FCF2, TdIF2, HSU15552, LPTS-RP2
Replacement Item:
This antibody may replace item sc-242592 from Santa Cruz Biotechnology.
Description of Target:
This gene is thought to be involved in chromatin remodeling and gene transcription. The encoded nuclear protein binds to and enhances the transcriptional activity of the estrogen receptor alpha, and also interacts with terminal deoxynucleotidyltransferase. The expression profile of this gene is a potential biomarker for chronic obstructive pulmonary disease.
Protein Size (# AA):
756
Molecular Weight:
83 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express DNTTIP2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express DNTTIP2.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human DNTTIP2
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: EMTNELKNDLKALKMRASMDPKRFYKKNDRDGFPKYFQIGTIVDNPADFY
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-DNTTIP2 (ARP78708_P050) antibody is Catalog # AAP78708
Datasheets/Manuals:
Printable datasheet for anti-DNTTIP2 (ARP78708_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...