DNTT Antibody - middle region (ARP52032_P050)

Catalog No: ARP52032_P050

WB Suggested Anti-DNTT Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Transfected 293T

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human DNTT
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 91%; Rabbit: 93%; Rat: 93%
• Peptide Sequence: Synthetic peptide located within the following region: LRRYATHERKMILDNHALYDKTKRIFLKAESEEEIFAHLGLDYIEPWERN
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-DNTT (ARP52032_P050) antibody is Catalog # AAP52032 (Previous Catalog # AAPP30257)

Target Info

• Reference: Kubota,T., (2007) Genes Cells 12 (8), 941-959
• Gene Symbol: DNTT
• Gene Full Name: Deoxynucleotidyltransferase, terminal
• Alias Symbols: TDT
• NCBI Gene Id: 1791
• Protein Name: DNA nucleotidylexotransferase
• Description of Target: DNTT is the template-independent DNA polymerase which catalyzes the random addition of deoxynucleoside 5'-triphosphate to the 3'-end of a DNA initiator. One of the in vivo functions of this enzyme is the addition of nucleotides at the junction (N region) of rearranged Ig heavy chain and T-cell receptor gene segments during the maturation of B- and T-cells.This gene is a member of the DNA polymerase type-X family and encodes a template-independent DNA polymerase that catalyzes the addition of deoxynucleotides to the 3'-hydroxyl terminus of oligonucleotide primers. In vivo, the encoded protein is expressed in a restricted population of normal and malignant pre-B and pre-T lymphocytes during early differentiation, where it generates antigen receptor diversity by synthesizing non-germ line elements (N-regions) at the junctions of rearranged Ig heavy chain and T cell receptor gene segments. Alternatively spliced transcript variants encoding different isoforms of this gene have been described.
• Uniprot ID: P04053
• Protein Accession #: NP_004079
• Nucleotide Accession #: NM_004088
• Protein Size (# AA): 509
• Molecular Weight: 58kDa
• Protein Interactions: REL; APOA1; DNTTIP1; UBC; PRPF19; DNTTIP2; PCNA; XRCC6; ABTB2; CUL3;