Size:100 ul
$289.00
In Stock
SKU
ARP75368_P050-FITC
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP75368_P050 Unconjugated

ARP75368_P050-HRP Conjugated

ARP75368_P050-Biotin Conjugated

DNPH1 Antibody - C-terminal region : FITC (ARP75368_P050-FITC)

Catalog#: ARP75368_P050-FITC
Domestic: within 1-2 days delivery | International: 1-2 days
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Predicted Species Reactivity Human
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Clonality Polyclonal
Host Rabbit
Conjugation FITC (FAM): Excitation 495 nm/ Emission 520 nm
Application WB
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human DNPH1
Purification Affinity purified
Peptide Sequence Synthetic peptide located within the following region: GRVLSAMIRGAADGSRFQVWDYEEGEVEALLDRYFEADPPGQVAASPDPT
Concentration 0.5 mg/ml
Blocking Peptide For anti-DNPH1 (ARP75368_P050-FITC) antibody is Catalog # AAP75368
Datasheets/Manuals Printable datasheet for anti-DNPH1 (ARP75368_P050-FITC) antibody
Target Reference N/A
Gene Symbol DNPH1
Alias Symbols DNPH1 {ECO:0000255|HAMAP-Rule:MF_03036
NCBI Gene Id 10591
Description of Target This gene was identified on the basis of its stimulation by c-Myc protein. The latter is a transcription factor that participates in the regulation of cell proliferation, differentiation, and apoptosis. The exact function of this gene is not known but studies in rat suggest a role in cellular proliferation and c-Myc-mediated transformation. Two alternative transcripts encoding different proteins have been described.
Swissprot Id O43598
Protein Size (# AA) 174
Molecular Weight 19kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express DNPH1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express DNPH1.
Protein Interactions DNPH1; UBC; PILRA; UBR1; ZNF593; SSU72; DSTN; UBA1; PRDX1; POT1; TERF1;
  1. What is the species homology for "DNPH1 Antibody - C-terminal region : FITC (ARP75368_P050-FITC)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "DNPH1 Antibody - C-terminal region : FITC (ARP75368_P050-FITC)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "DNPH1 Antibody - C-terminal region : FITC (ARP75368_P050-FITC)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "DNPH1 Antibody - C-terminal region : FITC (ARP75368_P050-FITC)"?

    This target may also be called "DNPH1 {ECO:0000255|HAMAP-Rule:MF_03036" in publications.

  5. What is the shipping cost for "DNPH1 Antibody - C-terminal region : FITC (ARP75368_P050-FITC)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "DNPH1 Antibody - C-terminal region : FITC (ARP75368_P050-FITC)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "DNPH1 Antibody - C-terminal region : FITC (ARP75368_P050-FITC)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "19kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "DNPH1 Antibody - C-terminal region : FITC (ARP75368_P050-FITC)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "DNPH1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "DNPH1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "DNPH1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "DNPH1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "DNPH1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "DNPH1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:DNPH1 Antibody - C-terminal region : FITC (ARP75368_P050-FITC)
Your Rating