- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for anti-DNMT3B (ARP49124_P050) antibody |
---|
Tested Species Reactivity | Human, Mouse |
---|---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | WB |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human DNMT3B |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
Peptide Sequence | Synthetic peptide located within the following region: GTGRLFFEFYHLLNYSRPKEGDDRPFFWMFENVVAMKVGDKRDISRFLEC |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-DNMT3B (ARP49124_P050) antibody is Catalog # AAP49124 (Previous Catalog # AAPY02321) |
Sample Type Confirmation | DNMT3B is supported by BioGPS gene expression data to be expressed in OVCAR3 |
Reference | Boland,M.J. (2008) J. Mol. Biol. 379 (3), 492-504 |
---|---|
Gene Symbol | DNMT3B |
Gene Full Name | DNA (cytosine-5-)-methyltransferase 3 beta |
Alias Symbols | ICF, ICF1, M.HsaIIIB |
NCBI Gene Id | 1789 |
Protein Name | DNA (cytosine-5)-methyltransferase 3B |
Description of Target | DNMT3B is required for genome wide de novo methylation and is essential for the establishment of DNA methylation patterns during development. DNA methylation is coordinated with methylation of histones. DNMT3B may preferentially methylate nucleosomal DNA within the nucleosome core region. DNMT3B may function as transcriptional co-repressor by associating with CBX4 and independently of DNA methylation. DNMT3B seems to be involved in gene silencing. In association with DNMT1 and via the recruitment of CTCFL/BORIS, DNMT3B is involved in activation of BAG1 gene expression by modulating dimethylation of promoter histone H3 at H3K4 and H3K9. CpG methylation is an epigenetic modification that is important for embryonic development, imprinting, and X-chromosome inactivation. Studies in mice have demonstrated that DNA methylation is required for mammalian development. This gene encodes a DNA methyltransferase which is thought to function in de novo methylation, rather than maintenance methylation. The protein localizes primarily to the nucleus and its expression is developmentally regulated. Mutations in this gene cause the immunodeficiency-centromeric instability-facial anomalies (ICF) syndrome. Six alternatively spliced transcript variants have been described. The full length sequences of variants 4 and 5 have not been determined. |
Uniprot ID | Q9UBC3-3 |
Protein Accession # | NP_787045 |
Nucleotide Accession # | NM_175849 |
Protein Size (# AA) | 770 |
Molecular Weight | 86kDa |
Protein Interactions | RBBP7; RBBP4; HDAC2; HDAC1; CHD4; MTA2; MTA1; POLR2H; POLR2C; POLR2A; DNMT1; LEO1; CDC73; PAF1; RTF1; CTR9; NRIP1; EZH2; DNMT3L; SUZ12; SIRT1; EED; UBC; EPHB1; CREB1; CBX5; TRIM28; ZFP57; UHRF2; UHRF1; MAP1LC3B; UBE2W; PLEKHJ1; DUSP23; CMTM6; PAM16; TSC22 |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "DNMT3B Antibody - middle region (ARP49124_P050)"?
The tested species reactivity for this item is "Human, Mouse". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish".
-
How long will it take to receive "DNMT3B Antibody - middle region (ARP49124_P050)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
-
What buffer format is "DNMT3B Antibody - middle region (ARP49124_P050)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "DNMT3B Antibody - middle region (ARP49124_P050)"?
This target may also be called "ICF, ICF1, M.HsaIIIB" in publications.
-
What is the shipping cost for "DNMT3B Antibody - middle region (ARP49124_P050)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "DNMT3B Antibody - middle region (ARP49124_P050)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "DNMT3B Antibody - middle region (ARP49124_P050)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "86kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "DNMT3B Antibody - middle region (ARP49124_P050)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "DNMT3B"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "DNMT3B"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "DNMT3B"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "DNMT3B"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "DNMT3B"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "DNMT3B"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.