Catalog No: ARP37033_P050-Biotin
Size:100ul
Price: $434.00
SKU
ARP37033_P050-Biotin
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

Dnmt1 Antibody - N-terminal region : Biotin (ARP37033_P050-Biotin)

Datasheets/ManualsPrintable datasheet for anti-Dnmt1 (ARP37033_P050-Biotin) antibody
Product Info
Predicted Species ReactivityMouse
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationBiotin
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of mouse Dnmt1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceMouse: 100%
Peptide SequenceSynthetic peptide located within the following region: SSVATRRTTRQTTITAHFTKGPTKRKPKEESEEGNSAESAAEERDQDKKR
Concentration0.5 mg/ml
Blocking PeptideFor anti-Dnmt1 (ARP37033_P050-Biotin) antibody is Catalog # AAP37033 (Previous Catalog # AAPP09231)
Gene SymbolDnmt1
Gene Full NameDNA methyltransferase (cytosine-5) 1
Alias SymbolsMTa, Dnmt, MCMT, Met1, Cxxc9, MTase, Met-1, Dnmt1o, MommeD, m.MmuI, MommeD2
NCBI Gene Id13433
Protein NameDNA (cytosine-5)-methyltransferase 1
Description of TargetDnmt1 methylates CpG residues.Dnmt1 preferentially methylates hemimethylated DNA. Dnmt1 associates with DNA replication sites in S phase maintaining the methylation pattern in the newly synthesized strand, that is essential for epigenetic inheritance.Dnmt1 associates with chromatin during G2 and M phases to maintain DNA methylation independently of replication. It is responsible for maintaining methylation patterns established in development. DNA methylation is coordinated with methylation of histones.Dnmt1 mediates transcriptional repression by direct binding to HDAC2. In association with DNMT3B and via the recruitment of CTCFL/BORIS, Dnmt1 is involved in activation of BAG1 gene expression by modulating dimethylation of promoter histone H3 at H3K4 and H3K9.
Uniprot IDP13864
Protein Accession #NP_034196
Nucleotide Accession #NM_010066
Protein Size (# AA)1619
Molecular Weight183kDa
Protein InteractionsUhrf1; Parp1; Eed; hist1h3g; DSK2; VPS9; Kat5; Ubc; Atm; NUB1; UBQLN1; SQSTM1; PSMD4; NBR1; RAD23B; Hesx1; Ezh2; Zbtb16; Cul3; Cdh1; Dmap1; Tcf3; hist1h4a; hist1h2bj; hist2h2ab; Dnmt1; Kcnq1ot1; Pla2g2a; Apc; Tox3; Rela; HDAC1;
  1. What is the species homology for "Dnmt1 Antibody - N-terminal region : Biotin (ARP37033_P050-Biotin)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Mouse".

  2. How long will it take to receive "Dnmt1 Antibody - N-terminal region : Biotin (ARP37033_P050-Biotin)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "Dnmt1 Antibody - N-terminal region : Biotin (ARP37033_P050-Biotin)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "Dnmt1 Antibody - N-terminal region : Biotin (ARP37033_P050-Biotin)"?

    This target may also be called "MTa, Dnmt, MCMT, Met1, Cxxc9, MTase, Met-1, Dnmt1o, MommeD, m.MmuI, MommeD2" in publications.

  5. What is the shipping cost for "Dnmt1 Antibody - N-terminal region : Biotin (ARP37033_P050-Biotin)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "Dnmt1 Antibody - N-terminal region : Biotin (ARP37033_P050-Biotin)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "Dnmt1 Antibody - N-terminal region : Biotin (ARP37033_P050-Biotin)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "183kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "Dnmt1 Antibody - N-terminal region : Biotin (ARP37033_P050-Biotin)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "DNMT1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "DNMT1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "DNMT1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "DNMT1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "DNMT1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "DNMT1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:Dnmt1 Antibody - N-terminal region : Biotin (ARP37033_P050-Biotin)
Your Rating
We found other products you might like!