Search Antibody, Protein, and ELISA Kit Solutions

DNM1L Antibody - N-terminal region (ARP52329_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP52329_P050-FITC Conjugated

ARP52329_P050-HRP Conjugated

ARP52329_P050-Biotin Conjugated

Tested Species Reactivity:
Human, Mouse
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-101270 from Santa Cruz Biotechnology.
The immunogen is a synthetic peptide directed towards the N terminal region of human DNM1L
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 85%; Zebrafish: 93%
Complete computational species homology data:
Anti-DNM1L (ARP52329_P050)
Peptide Sequence:
Synthetic peptide located within the following region: IRQEIENETERISGNNKGVSPEPIHLKIFSPNVVNLTLVDLPGMTKVPVG
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-DNM1L (ARP52329_P050) antibody is Catalog # AAP52329 (Previous Catalog # AAPP42835)
Printable datasheet for anti-DNM1L (ARP52329_P050) antibody
Sample Type Confirmation:

DNM1L is supported by BioGPS gene expression data to be expressed in HeLa


Su, Y. C., Chiu, H. W., Hung, J. C. & Hong, J. R. Beta-nodavirus B2 protein induces hydrogen peroxide production, leading to Drp1-recruited mitochondrial fragmentation and cell death via mitochondrial targeting. Apoptosis 19, 1457-70 (2014). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish 25008790

Gene Symbol:
Official Gene Full Name:
Dynamin 1-like
Alias Symbols:
NCBI Gene Id:
Protein Name:
Dynamin-1-like protein
Description of Target:
The protein encoded by this gene is a member of the dynamin superfamily of GTPases. Members of the dynamin-related subfamily, including the S. cerevisiae proteins Dnm1 and Vps1, contain the N-terminal tripartite GTPase domain but do not have the pleckstrin homology or proline-rich domains. This protein establishes mitochondrial morphology through a role in distributing mitochondrial tubules throughout the cytoplasm. The gene has 3 alternatively spliced transcripts encoding different isoforms. These transcripts are alternatively polyadenylated.
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Size (# AA):
Molecular Weight:
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express DNM1L.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express DNM1L.
Protein Interactions:

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...