Search Antibody, Protein, and ELISA Kit Solutions

DNM1L Antibody - N-terminal region (ARP52329_P050)

100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP52329_P050-FITC Conjugated

ARP52329_P050-HRP Conjugated

ARP52329_P050-Biotin Conjugated

Gene Symbol:
DNM1L
Official Gene Full Name:
Dynamin 1-like
NCBI Gene Id:
10059
Protein Name:
Dynamin-1-like protein
Swissprot Id:
O00429
Protein Accession #:
NP_036192
Nucleotide Accession #:
NM_012062
Alias Symbols:
DLP1, DRP1, DVLP, DYMPLE, HDYNIV, VPS1, EMPF, DYNIV-11
Replacement Item:
This antibody may replace item sc-101270 from Santa Cruz Biotechnology.
Description of Target:
The protein encoded by this gene is a member of the dynamin superfamily of GTPases. Members of the dynamin-related subfamily, including the S. cerevisiae proteins Dnm1 and Vps1, contain the N-terminal tripartite GTPase domain but do not have the pleckstrin homology or proline-rich domains. This protein establishes mitochondrial morphology through a role in distributing mitochondrial tubules throughout the cytoplasm. The gene has 3 alternatively spliced transcripts encoding different isoforms. These transcripts are alternatively polyadenylated.
Protein Size (# AA):
736
Molecular Weight:
82kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express DNM1L.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express DNM1L.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human DNM1L
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Tested Species Reactivity:
Human, Mouse
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 85%; Zebrafish: 93%
Complete computational species homology data:
Anti-DNM1L (ARP52329_P050)
Peptide Sequence:
Synthetic peptide located within the following region: IRQEIENETERISGNNKGVSPEPIHLKIFSPNVVNLTLVDLPGMTKVPVG
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
ZBTB24; UBC; SCG3; SH3GL1; RRM2; MAGEA3; MAGEA1; MARCH5; EGFR; VPS26A; SSB; CARS; ATP6V1C1; APEH; PSMG3; FAM129B; TBC1D15; CYHR1; ARFIP1; JMJD6; SEC24A; SOX2; DNM1L; MIEF2; MFF; PEX14; LRRK2; MIEF1; COPS5; GABRR1; MUL1; SUMO2; PARK2; PEX25; PEX11G; PEX11A
Blocking Peptide:
For anti-DNM1L (ARP52329_P050) antibody is Catalog # AAP52329 (Previous Catalog # AAPP42835)
Datasheets/Manuals:
Printable datasheet for anti-DNM1L (ARP52329_P050) antibody
Sample Type Confirmation:

DNM1L is supported by BioGPS gene expression data to be expressed in HeLa

Publications:

Su, Y. C., Chiu, H. W., Hung, J. C. & Hong, J. R. Beta-nodavirus B2 protein induces hydrogen peroxide production, leading to Drp1-recruited mitochondrial fragmentation and cell death via mitochondrial targeting. Apoptosis 19, 1457-70 (2014). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish 25008790

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...