Size:100 ul
$319.00
In Stock
SKU
ARP52329_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP52329_P050-FITC Conjugated

ARP52329_P050-HRP Conjugated

ARP52329_P050-Biotin Conjugated

More Information
Tested Species Reactivity Human, Mouse
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-101270 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human DNM1L
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 85%; Zebrafish: 93%
Complete computational species homology data Anti-DNM1L (ARP52329_P050)
Peptide Sequence Synthetic peptide located within the following region: IRQEIENETERISGNNKGVSPEPIHLKIFSPNVVNLTLVDLPGMTKVPVG
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-DNM1L (ARP52329_P050) antibody is Catalog # AAP52329 (Previous Catalog # AAPP42835)
Datasheets/Manuals Printable datasheet for anti-DNM1L (ARP52329_P050) antibody
Sample Type Confirmation

DNM1L is supported by BioGPS gene expression data to be expressed in HeLa

Publications

Su, Y. C., Chiu, H. W., Hung, J. C. & Hong, J. R. Beta-nodavirus B2 protein induces hydrogen peroxide production, leading to Drp1-recruited mitochondrial fragmentation and cell death via mitochondrial targeting. Apoptosis 19, 1457-70 (2014). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish 25008790

Gene Symbol DNM1L
Official Gene Full Name Dynamin 1-like
Alias Symbols DLP1, DRP1, DVLP, DYMPLE, HDYNIV, VPS1, EMPF, DYNIV-11
NCBI Gene Id 10059
Protein Name Dynamin-1-like protein
Description of Target The protein encoded by this gene is a member of the dynamin superfamily of GTPases. Members of the dynamin-related subfamily, including the S. cerevisiae proteins Dnm1 and Vps1, contain the N-terminal tripartite GTPase domain but do not have the pleckstrin homology or proline-rich domains. This protein establishes mitochondrial morphology through a role in distributing mitochondrial tubules throughout the cytoplasm. The gene has 3 alternatively spliced transcripts encoding different isoforms. These transcripts are alternatively polyadenylated.
Swissprot Id O00429
Protein Accession # NP_036192
Nucleotide Accession # NM_012062
Protein Size (# AA) 736
Molecular Weight 82kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express DNM1L.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express DNM1L.
Protein Interactions ZBTB24; UBC; SCG3; SH3GL1; RRM2; MAGEA3; MAGEA1; MARCH5; EGFR; VPS26A; SSB; CARS; ATP6V1C1; APEH; PSMG3; FAM129B; TBC1D15; CYHR1; ARFIP1; JMJD6; SEC24A; SOX2; DNM1L; MIEF2; MFF; PEX14; LRRK2; MIEF1; COPS5; GABRR1; MUL1; SUMO2; PARK2; PEX25; PEX11G; PEX11A
  1. What is the species homology for "DNM1L Antibody - N-terminal region (ARP52329_P050)"?

    The tested species reactivity for this item is "Human, Mouse". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish".

  2. How long will it take to receive "DNM1L Antibody - N-terminal region (ARP52329_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "DNM1L Antibody - N-terminal region (ARP52329_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "DNM1L Antibody - N-terminal region (ARP52329_P050)"?

    This target may also be called "DLP1, DRP1, DVLP, DYMPLE, HDYNIV, VPS1, EMPF, DYNIV-11" in publications.

  5. What is the shipping cost for "DNM1L Antibody - N-terminal region (ARP52329_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "DNM1L Antibody - N-terminal region (ARP52329_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "DNM1L Antibody - N-terminal region (ARP52329_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "82kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "DNM1L Antibody - N-terminal region (ARP52329_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "DNM1L"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "DNM1L"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "DNM1L"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "DNM1L"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "DNM1L"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "DNM1L"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:DNM1L Antibody - N-terminal region (ARP52329_P050)
Your Rating
We found other products you might like!