Search Antibody, Protein, and ELISA Kit Solutions

DND1 Antibody - N-terminal region : FITC (ARP72453_P050-FITC)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP72453_P050 Unconjugated

ARP72453_P050-HRP Conjugated

ARP72453_P050-Biotin Conjugated

Gene Symbol:
DND1
NCBI Gene Id:
373863
Swissprot Id:
Q8IYX4
Protein Accession #:
NP_919225
Alias Symbols:
DND1, RBMS4,
Replacement Item:
This antibody may replace item sc-130493 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes a protein that binds to microRNA-targeting sequences of mRNAs, inhibiting microRNA-mediated repression. Reduced expression of this gene has been implicated in tongue squamous cell carcinoma. Two pseudogenes of this gene are located on the long arm of chromosome 17.
Protein Size (# AA):
353
Molecular Weight:
38kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express DND1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express DND1.
Immunogen:
The immunogen is a synthetic peptide directed towards the N-terminal region of Human DND1
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: MQSKRDCELWCERVNPENKAALEAWVRETGIRLVQVNGQRKYGGPPPGWV
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
0.5 mg/ml
Blocking Peptide:
For anti-DND1 (ARP72453_P050-FITC) antibody is Catalog # AAP72453
Datasheets/Manuals:
Printable datasheet for anti-DND1 (ARP72453_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...