Search Antibody, Protein, and ELISA Kit Solutions

DND1 Antibody - C-terminal region (ARP41198_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP41198_P050-FITC Conjugated

ARP41198_P050-HRP Conjugated

ARP41198_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Dead end homolog 1 (zebrafish)
NCBI Gene Id:
Protein Name:
Dead end protein homolog 1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
MGC34750, RBMS4
Replacement Item:
This antibody may replace item sc-130493 from Santa Cruz Biotechnology.
Description of Target:
DND1 contains 2 RRM (RNA recognition motif) domains. It may play a role during primordial germ cell (PGC) development. However, DND1 does not seem to be essential for PGC migration
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express DND1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express DND1.
The immunogen is a synthetic peptide directed towards the C terminal region of human DND1
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 79%; Guinea Pig: 79%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 86%; Rabbit: 86%; Rat: 100%
Complete computational species homology data:
Anti-DND1 (ARP41198_P050)
Peptide Sequence:
Synthetic peptide located within the following region: HRFWYQVVIPGHPVPFSGLIWVVLTLDGRDGHEVAKDAVSVRLLQALSES
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-DND1 (ARP41198_P050) antibody is Catalog # AAP41198 (Previous Catalog # AAPP22573)
Printable datasheet for anti-DND1 (ARP41198_P050) antibody
Sample Type Confirmation:

DND1 is supported by BioGPS gene expression data to be expressed in Jurkat

Target Reference:
Linger,R., (2008) Genes Chromosomes Cancer 47 (3), 247-252

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...