Search Antibody, Protein, and ELISA Kit Solutions

DNALI1 antibody - N-terminal region (ARP53611_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP53611_P050-FITC Conjugated

ARP53611_P050-HRP Conjugated

ARP53611_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Dynein, axonemal, light intermediate chain 1
Protein Name:
Axonemal dynein light intermediate polypeptide 1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
P28, dJ423B22.5, hp28
Replacement Item:
This antibody may replace item sc-116188, HPA028305
Description of Target:
DNALI1 is the human homolog of the Chlamydomonas inner dynein arm gene, p28. The precise function of this gene is not known, however, it is a potential candidate for immotile cilia syndrome (ICS). Ultrastructural defects of the inner dynein arms are seen in patients with ICS. Immotile mutant strains of Chlamydomonas, a biflagellated algae, exhibit similar defects. This gene is the human homolog of the Chlamydomonas inner dynein arm gene, p28. The precise function of this gene is not known, however, it is a potential candidate for immotile cilia syndrome (ICS). Ultrastructural defects of the inner dynein arms are seen in patients with ICS. Immotile mutant strains of Chlamydomonas, a biflagellated algae, exhibit similar defects.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express DNALI1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express DNALI1.
The immunogen is a synthetic peptide directed towards the N terminal region of human DNALI1
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-DNALI1 (ARP53611_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MVTANKAHTGQGSCWVATLASAMIPPADSLLKYDTPVLVSRNTEKRSPKA
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-DNALI1 (ARP53611_P050) antibody is Catalog # AAP53611 (Previous Catalog # AAPP30451)
Printable datasheet for anti-DNALI1 (ARP53611_P050) antibody
Target Reference:
Combs,J., (2006) Proc. Natl. Acad. Sci. U.S.A. 103 (40), 14883-14888

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...