DNAK Recombinant Protein (Mycoplasma pneumoniae) (OPCA04236)

Catalog No: OPCA04236

Product Info

• Predicted Species Reactivity: Mycoplasma pneumoniae
• Product Format: Liquid or Lyophilized powder
• Additional Information: Species Specificity Detail: Mycoplasma pneumoniae (strain ATCC 29342 / M129)
• Reconstitution and Storage: -20°C or -80°C
• Formulation: Tris-base, 50% glycerol
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: QGERPMARDNKSLGRFNLGGIQPAPKGKPQIEITFSLDANGILNVKAKDLTTQKENSITISDNGNLSEEEIQKMIRDAEANKERDNVIRERIELRNEGESIVSTIKEILQSPEAKDFPKEEKEKLDKITGGIDAAIKANDYTKLKAEIENFKKWREEMAKKYNPNGDQGQPAQ
• Protein Sequence: QGERPMARDNKSLGRFNLGGIQPAPKGKPQIEITFSLDANGILNVKAKDLTTQKENSITISDNGNLSEEEIQKMIRDAEANKERDNVIRERIELRNEGESIVSTIKEILQSPEAKDFPKEEKEKLDKITGGIDAAIKANDYTKLKAEIENFKKWREEMAKKYNPNGDQGQPAQ
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: E.coli
• Protein Range: 423-595 aa
• Tag: N-terminal 6xHis-SUMO-tagged
• Reference: Complete sequence analysis of the genome of the bacterium Mycoplasma pneumoniae.Himmelreich R., Hilbert H., Plagens H., Pirkl E., Li B.-C., Herrmann R.Nucleic Acids Res. 24:4420-4449(1996)

Target Info

• Gene Symbol: dnaK
• Gene Full Name: molecular chaperone DnaK
• Alias Symbols: Heat shock 70 kDa protein;Heat shock protein 70;HSP70;molecular chaperone DnaK;MPN_434;MPN_RS02455;MPN434.
• NCBI Gene Id: 876838
• Protein Name: Chaperone protein DnaK
• Description of Target: Acts as a chaperone.
• Uniprot ID: P75344
• Protein Accession #: NP_110122
• Nucleotide Accession #: NC_000912
• Protein Size (# AA): Recombinant
• Molecular Weight: 35.5 kDa