Search Antibody, Protein, and ELISA Kit Solutions

DNAJC28 Antibody - middle region (ARP86707_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Gene Symbol:
DNAJC28
Official Gene Full Name:
DnaJ heat shock protein family (Hsp40) member C28
NCBI Gene Id:
54943
Protein Name:
dnaJ homolog subfamily C member 28
Swissprot Id:
Q9NX36
Protein Accession #:
NP_001035282.1
Nucleotide Accession #:
NM_001040192.2
Alias Symbols:
C21orf55, C21orf78
Description of Target:
May have a role in protein folding or as a chaperone.
Protein Size (# AA):
388
Molecular Weight:
46 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express DNAJC28.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express DNAJC28.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human DNAJC28
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: LVEDLIQESMAKGDFDNLSGKGKPLKKFSDCSYIDPMTHNLNRILIDNGY
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-DNAJC28 (ARP86707_P050) antibody is Catalog # AAP86707
Datasheets/Manuals:
Printable datasheet for anti-DNAJC28 (ARP86707_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...