DNAJB14 Antibody - N-terminal region (ARP70147_P050)

Catalog No: ARP70147_P050

Host: Rabbit
Target Name: DNAJB14
Sample Type: 721_B Whole Cell lysates
Antibody Dilution: 1.0ug/mlDNAJB14 is supported by BioGPS gene expression data to be expressed in 721_B

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Rat, Cow, Dog, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human DNAJB14
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 92%; Horse: 86%; Human: 100%; Pig: 100%; Rabbit: 100%; Rat: 83%
• Peptide Sequence: Synthetic peptide located within the following region: SGDQSKPNCTKDSTSGSGEGGKGYTKDQVDGVLSINKCKNYYEVLGVTKD
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-DNAJB14 (ARP70147_P050) antibody is Catalog # AAP70147
• Sample Type Confirmation:

  DNAJB14 is supported by BioGPS gene expression data to be expressed in 721_B

Target Info

• Gene Symbol: DNAJB14
• Alias Symbols: EGNR9427, PRO34683
• NCBI Gene Id: 79982
• Protein Name: DnaJ homolog subfamily B member 14
• Description of Target: DNAJB14 may act as a co-chaperone.
• Uniprot ID: Q8TBM8
• Protein Accession #: NP_001026893
• Nucleotide Accession #: NM_001031723
• Protein Size (# AA): 379
• Molecular Weight: 42kDa
• Protein Interactions: UBC; APP; HSPA8;