Catalog No: ARP54795_P050-Biotin
Price: $434.00
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

DNAJB1 Antibody - N-terminal region : Biotin (ARP54795_P050-Biotin)

Datasheets/ManualsPrintable datasheet for anti-DNAJB1 (ARP54795_P050-Biotin) antibody
Product Info
ReferenceCheng,X., (2008) J. Virol. 82 (3), 1229-1237
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ApplicationWB, IHC
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human DNAJB1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 86%; Dog: 92%; Human: 100%; Mouse: 92%; Rat: 92%
Peptide SequenceSynthetic peptide located within the following region: GSGPSGGSGGGANGTSFSYTFHGDPHAMFAEFFGGRNPFDTFFGQRNGEE
Concentration0.5 mg/ml
Blocking PeptideFor anti-DNAJB1 (ARP54795_P050-Biotin) antibody is Catalog # AAP54795 (Previous Catalog # AAPP31590)
Gene SymbolDNAJB1
Gene Full NameDnaJ (Hsp40) homolog, subfamily B, member 1
Alias SymbolsHdj1, Sis1, HSPF1, Hsp40, RSPH16B
NCBI Gene Id3337
Protein NameDnaJ homolog subfamily B member 1
Description of TargetDNAJB1 interacts with HSP70 and can stimulate its ATPase activity. It stimulates the association between HSC70 and HIP.
Uniprot IDP25685
Protein Accession #NP_006136
Nucleotide Accession #NM_006145
Protein Size (# AA)340
Molecular Weight38kDa
  1. What is the species homology for "DNAJB1 Antibody - N-terminal region : Biotin (ARP54795_P050-Biotin)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog".

  2. How long will it take to receive "DNAJB1 Antibody - N-terminal region : Biotin (ARP54795_P050-Biotin)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "DNAJB1 Antibody - N-terminal region : Biotin (ARP54795_P050-Biotin)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact

  4. What are other names for "DNAJB1 Antibody - N-terminal region : Biotin (ARP54795_P050-Biotin)"?

    This target may also be called "Hdj1, Sis1, HSPF1, Hsp40, RSPH16B" in publications.

  5. What is the shipping cost for "DNAJB1 Antibody - N-terminal region : Biotin (ARP54795_P050-Biotin)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "DNAJB1 Antibody - N-terminal region : Biotin (ARP54795_P050-Biotin)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "DNAJB1 Antibody - N-terminal region : Biotin (ARP54795_P050-Biotin)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "38kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "DNAJB1 Antibody - N-terminal region : Biotin (ARP54795_P050-Biotin)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "DNAJB1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "DNAJB1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "DNAJB1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "DNAJB1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "DNAJB1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "DNAJB1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:DNAJB1 Antibody - N-terminal region : Biotin (ARP54795_P050-Biotin)
Your Rating
We found other products you might like!