Search Antibody, Protein, and ELISA Kit Solutions

DNAJB1 antibody - N-terminal region (ARP54795_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP54795_P050-FITC Conjugated

ARP54795_P050-HRP Conjugated

ARP54795_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
DnaJ (Hsp40) homolog, subfamily B, member 1
Protein Name:
DnaJ homolog subfamily B member 1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
HSPF1, Hdj1, Hsp40, Sis1, RSPH16B
Replacement Item:
This antibody may replace item sc-114001 from Santa Cruz Biotechnology.
Description of Target:
DNAJB1 interacts with HSP70 and can stimulate its ATPase activity. It stimulates the association between HSC70 and HIP.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express DNAJB1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express DNAJB1.
The immunogen is a synthetic peptide directed towards the N terminal region of human DNAJB1
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 92%; Human: 100%; Mouse: 92%; Rat: 92%
Complete computational species homology data:
Anti-DNAJB1 (ARP54795_P050)
Peptide Sequence:
Synthetic peptide located within the following region: GSGPSGGSGGGANGTSFSYTFHGDPHAMFAEFFGGRNPFDTFFGQRNGEE
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-DNAJB1 (ARP54795_P050) antibody is Catalog # AAP54795 (Previous Catalog # AAPP31590)
Printable datasheet for anti-DNAJB1 (ARP54795_P050) antibody
Target Reference:
Cheng,X., (2008) J. Virol. 82 (3), 1229-1237

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...