Aviva Systems Biology office will be closed for Christmas and New Year Holiday - December 24-25, 2018 and January 1, 2019.
Please go here for more info.

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

DNAJB1 antibody - N-terminal region (ARP54795_P050)

100 ul
$319.00
In Stock

Conjugation Options

ARP54795_P050-FITC Conjugated

ARP54795_P050-HRP Conjugated

ARP54795_P050-Biotin Conjugated

Gene Symbol:
DNAJB1
NCBI Gene Id:
3337
Official Gene Full Name:
DnaJ (Hsp40) homolog, subfamily B, member 1
Protein Name:
DnaJ homolog subfamily B member 1
Swissprot Id:
P25685
Protein Accession #:
NP_006136
Nucleotide Accession #:
NM_006145
Alias Symbols:
HSPF1, Hdj1, Hsp40, Sis1, RSPH16B
Replacement Item:
This antibody may replace item sc-114001 from Santa Cruz Biotechnology.
Description of Target:
DNAJB1 interacts with HSP70 and can stimulate its ATPase activity. It stimulates the association between HSC70 and HIP.
Protein Size (# AA):
340
Molecular Weight:
38kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB, IHC
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express DNAJB1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express DNAJB1.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human DNAJB1
Species Reactivity:
Cow, Dog, Human, Mouse, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 92%; Human: 100%; Mouse: 92%; Rat: 92%
Complete computational species homology data:
Anti-DNAJB1 (ARP54795_P050)
Peptide Sequence:
Synthetic peptide located within the following region: GSGPSGGSGGGANGTSFSYTFHGDPHAMFAEFFGGRNPFDTFFGQRNGEE
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
HUWE1; ZFP36; UBC; BAG1; BAG2; BAG4; MLF2; CDC37; NUDC; MDM2; TP53; PDE12; RNASEH2B; UBQLN2; XPO7; WDR4; DPYSL2; ADSL; ANKRD28; PGR; HSPA8; SLC12A3; FN1; BRCA1; SNCA; PSEN2; CYP2C8; APP; A2M; ECSIT; MAST1; PHLDA1; HTT; CUL3; ISG15; TERF1; SPP1; HIF1A; NRA
Blocking Peptide:
For anti-DNAJB1 (ARP54795_P050) antibody is Catalog # AAP54795 (Previous Catalog # AAPP31590)
Datasheets/Manuals:
Printable datasheet for anti-DNAJB1 (ARP54795_P050) antibody
Target Reference:
Cheng,X., (2008) J. Virol. 82 (3), 1229-1237

Tell us what you think about this item!

Write A Review
    Please, wait...