Size:100 ul
Special Price $229.00 Regular Price $319.00
In Stock
SKU
ARP54795_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP54795_P050-FITC Conjugated

ARP54795_P050-HRP Conjugated

ARP54795_P050-Biotin Conjugated

DNAJB1 Antibody - N-terminal region (ARP54795_P050)

Catalog#: ARP54795_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Human, Mouse, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB, IHC
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-114001 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human DNAJB1
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 92%; Human: 100%; Mouse: 92%; Rat: 92%
Complete computational species homology data Anti-DNAJB1 (ARP54795_P050)
Peptide Sequence Synthetic peptide located within the following region: GSGPSGGSGGGANGTSFSYTFHGDPHAMFAEFFGGRNPFDTFFGQRNGEE
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-DNAJB1 (ARP54795_P050) antibody is Catalog # AAP54795 (Previous Catalog # AAPP31590)
Datasheets/Manuals Printable datasheet for anti-DNAJB1 (ARP54795_P050) antibody
Target Reference Cheng,X., (2008) J. Virol. 82 (3), 1229-1237
Gene Symbol DNAJB1
Official Gene Full Name DnaJ (Hsp40) homolog, subfamily B, member 1
Alias Symbols HSPF1, Hdj1, Hsp40, Sis1, RSPH16B
NCBI Gene Id 3337
Protein Name DnaJ homolog subfamily B member 1
Description of Target DNAJB1 interacts with HSP70 and can stimulate its ATPase activity. It stimulates the association between HSC70 and HIP.
Swissprot Id P25685
Protein Accession # NP_006136
Nucleotide Accession # NM_006145
Protein Size (# AA) 340
Molecular Weight 38kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express DNAJB1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express DNAJB1.
Protein Interactions HUWE1; ZFP36; UBC; BAG1; BAG2; BAG4; MLF2; CDC37; NUDC; MDM2; TP53; PDE12; RNASEH2B; UBQLN2; XPO7; WDR4; DPYSL2; ADSL; ANKRD28; PGR; HSPA8; SLC12A3; FN1; BRCA1; SNCA; PSEN2; CYP2C8; APP; A2M; ECSIT; MAST1; PHLDA1; HTT; CUL3; ISG15; TERF1; SPP1; HIF1A; NRA
  1. What is the species homology for "DNAJB1 Antibody - N-terminal region (ARP54795_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Human, Mouse, Rat".

  2. How long will it take to receive "DNAJB1 Antibody - N-terminal region (ARP54795_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "DNAJB1 Antibody - N-terminal region (ARP54795_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "DNAJB1 Antibody - N-terminal region (ARP54795_P050)"?

    This target may also be called "HSPF1, Hdj1, Hsp40, Sis1, RSPH16B" in publications.

  5. What is the shipping cost for "DNAJB1 Antibody - N-terminal region (ARP54795_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "DNAJB1 Antibody - N-terminal region (ARP54795_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "DNAJB1 Antibody - N-terminal region (ARP54795_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "38kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "DNAJB1 Antibody - N-terminal region (ARP54795_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "DNAJB1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "DNAJB1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "DNAJB1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "DNAJB1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "DNAJB1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "DNAJB1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:DNAJB1 Antibody - N-terminal region (ARP54795_P050)
Your Rating
We found other products you might like!