Search Antibody, Protein, and ELISA Kit Solutions

Dnajb1 Antibody - C-terminal region (ARP54796_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP54796_P050-FITC Conjugated

ARP54796_P050-HRP Conjugated

ARP54796_P050-Biotin Conjugated

Tested Species Reactivity:
Mouse
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Yeast, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Dnajb1
Official Gene Full Name:
DnaJ (Hsp40) homolog, subfamily B, member 1
NCBI Gene Id:
81489
Protein Name:
DnaJ homolog subfamily B member 1
Swissprot Id:
Q9QYJ3
Protein Accession #:
NP_061278
Nucleotide Accession #:
NM_018808
Alias Symbols:
0610007I11Rik, HSPF1, Hsp40
Replacement Item:
This antibody may replace item sc-114001 from Santa Cruz Biotechnology.
Description of Target:
Dnajb1 interacts with HSP70 and can stimulate its ATPase activity. It stimulates the association between HSC70 and HIP.
Protein Size (# AA):
340
Molecular Weight:
37kDa
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express Dnajb1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express Dnajb1.
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rat: 100%; Yeast: 100%; Zebrafish: 85%
Complete computational species homology data:
Anti-Dnajb1 (ARP54796_P050)
Peptide Sequence:
Synthetic peptide located within the following region: VFKDVIRPGMRRKVPGEGLPLPKTPEKRGDLVIEFEVIFPERIPVSSRTI
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Htt; Atxn3;
Blocking Peptide:
For anti-Dnajb1 (ARP54796_P050) antibody is Catalog # AAP54796
Datasheets/Manuals:
Printable datasheet for anti-Dnajb1 (ARP54796_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...