Catalog No: ARP52547_P050
Price: $0.00
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

DNAAF4 Antibody - C-terminal region (ARP52547_P050)

Datasheets/ManualsPrintable datasheet for anti-DNAAF4 (ARP52547_P050) antibody
Product Info
ReferenceMarino,C., (2007) Genes Brain Behav. 6 (7), 640-646
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human DYX1C1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Peptide SequenceSynthetic peptide located within the following region: FATENYLAAINAYNLAIRLNNKMPLLYLNRAACHLKLKNLHKAIEDSSKA
Concentration0.5 mg/ml
Blocking PeptideFor anti-DNAAF4 (ARP52547_P050) antibody is Catalog # AAP52547 (Previous Catalog # AAPS32112)
Gene SymbolDNAAF4
Gene Full Namedynein axonemal assembly factor 4
Alias SymbolsRD, DYX1, EKN1, DYXC1, CILD25, DYX1C1
NCBI Gene Id161582
Protein Namedynein assembly factor 4, axonemal
Description of TargetThis gene encodes a tetratricopeptide repeat domain-containing protein. The encoded protein interacts with estrogen receptors and the heat shock proteins, Hsp70 and Hsp90. An homologous protein in rat has been shown to function in neuronal migration in the developing neocortex. A chromosomal translocation involving this gene is associated with a susceptibility to developmental dyslexia. Mutations in this gene are associated with deficits in reading and spelling. Alternative splicing results in multiple transcript variants. Read-through transcription also exists between this gene and the downstream cell cycle progression 1 (CCPG1) gene.
Uniprot IDQ8WXU2
Protein Accession #NP_570722
Nucleotide Accession #NM_130810
Protein Size (# AA)420
Molecular Weight48kDa
Protein InteractionsSPDL1; KDM1A; Stub1; Hspa1b; GABARAPL1; GABARAP; HSPA1A;
  1. What is the species homology for "DNAAF4 Antibody - C-terminal region (ARP52547_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish".

  2. How long will it take to receive "DNAAF4 Antibody - C-terminal region (ARP52547_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "DNAAF4 Antibody - C-terminal region (ARP52547_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact

  4. What are other names for "DNAAF4 Antibody - C-terminal region (ARP52547_P050)"?

    This target may also be called "RD, DYX1, EKN1, DYXC1, CILD25, DYX1C1" in publications.

  5. What is the shipping cost for "DNAAF4 Antibody - C-terminal region (ARP52547_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "DNAAF4 Antibody - C-terminal region (ARP52547_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "DNAAF4 Antibody - C-terminal region (ARP52547_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "48kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "DNAAF4 Antibody - C-terminal region (ARP52547_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "DNAAF4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "DNAAF4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "DNAAF4"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "DNAAF4"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "DNAAF4"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "DNAAF4"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:DNAAF4 Antibody - C-terminal region (ARP52547_P050)
Your Rating