Aviva Systems Biology office will be closed for Memorial Day - May 27, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

DNAAF1 Antibody - middle region : FITC (ARP75849_P050-FITC)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP75849_P050 Unconjugated

ARP75849_P050-HRP Conjugated

ARP75849_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
DNAAF1
Official Gene Full Name:
dynein axonemal assembly factor 1
NCBI Gene Id:
123872
Protein Name:
dynein assembly factor 1, axonemal
Swissprot Id:
Q8NEP3-3
Alias Symbols:
swt, ODA7, CILD13, LRRC50
Description of Target:
The protein encoded by this gene is cilium-specific and is required for the stability of the ciliary architecture. It is involved in the regulation of microtubule-based cilia and actin-based brush border microvilli. Mutations in this gene are associated with primary ciliary dyskinesia-13. Alternative splicing results in multiple transcript variants.
Protein Size (# AA):
418
Molecular Weight:
45kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express DNAAF1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express DNAAF1.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of Human DAAF1
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: NLMGNPVIRQIPNYRRTVTVRLKHLTYLDDRPVFPKDRACAEAWARGGYA
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
1 mg/ml
Protein Interactions:
UBC;
Blocking Peptide:
For anti-DNAAF1 (ARP75849_P050-FITC) antibody is Catalog # AAP75849
Datasheets/Manuals:
Printable datasheet for anti-DNAAF1 (ARP75849_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm
Target Reference:
N/A

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...