Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP34602_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP34602_P050-FITC Conjugated

ARP34602_P050-HRP Conjugated

ARP34602_P050-Biotin Conjugated

DMTF1 Antibody - C-terminal region (ARP34602_P050)

Catalog#: ARP34602_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityDog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-38068 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human DMTF1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceDog: 92%; Guinea Pig: 91%; Horse: 92%; Human: 100%; Mouse: 92%; Rabbit: 92%; Rat: 92%
Complete computational species homology dataAnti-DMTF1 (ARP34602_P050)
Peptide SequenceSynthetic peptide located within the following region: SFNDAHVSKFSDQNSTELMNSVMVRTEEEISDTDLKQEESPSDLASAYVT
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-DMTF1 (ARP34602_P050) antibody is Catalog # AAP34602 (Previous Catalog # AAPP23615)
Datasheets/ManualsPrintable datasheet for anti-DMTF1 (ARP34602_P050) antibody
Publications

Yang, KC; Kitamura, Y; Wu, CC; Chang, HH; Ling, TY; Kuo, TF; Tooth Germ-Like Construct Transplantation for Whole-Tooth Regeneration: An In Vivo Study in the Miniature Pig. 40, E39-50 (2016). IHC, WB, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 26582651

Gene SymbolDMTF1
Official Gene Full Namecyclin D binding myb like transcription factor 1
Alias SymbolsDMP1, DMTF, MRUL, hDMP1
NCBI Gene Id9988
Protein Namecyclin-D-binding Myb-like transcription factor 1
Description of TargetThis gene encodes a transcription factor that contains a cyclin D-binding domain, three central Myb-like repeats, and two flanking acidic transactivation domains at the N- and C-termini. The encoded protein is induced by the oncogenic Ras signaling pathway and functions as a tumor suppressor by activating the transcription of ARF and thus the ARF-p53 pathway to arrest cell growth or induce apoptosis. It also activates the transcription of aminopeptidase N and may play a role in hematopoietic cell differentiation. The transcriptional activity of this protein is regulated by binding of D-cyclins. This gene is hemizygously deleted in approximately 40% of human non-small-cell lung cancer and is a potential prognostic and gene-therapy target for non-small-cell lung cancer. Multiple transcript variants encoding different isoforms have been found for this gene.
Swissprot IdQ9Y222
Protein Accession #EAW76962
Nucleotide Accession #NM_001142326
Protein Size (# AA)494
Molecular Weight54kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express DMTF1.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express DMTF1.
Protein InteractionsSRA1; TP53; ATF7IP; CCND1; CCND3; CCND2;
Write Your Own Review
You're reviewing:DMTF1 Antibody - C-terminal region (ARP34602_P050)
Your Rating
Free Microscope
Aviva Live Chat
Aviva Travel Grant
Aviva Blast Tool