Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP34602_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP34602_P050-FITC Conjugated

ARP34602_P050-HRP Conjugated

ARP34602_P050-Biotin Conjugated

DMTF1 Antibody - C-terminal region (ARP34602_P050)

Catalog#: ARP34602_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-38068 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human DMTF1
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Dog: 92%; Guinea Pig: 91%; Horse: 92%; Human: 100%; Mouse: 92%; Rabbit: 92%; Rat: 92%
Complete computational species homology data Anti-DMTF1 (ARP34602_P050)
Peptide Sequence Synthetic peptide located within the following region: SFNDAHVSKFSDQNSTELMNSVMVRTEEEISDTDLKQEESPSDLASAYVT
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-DMTF1 (ARP34602_P050) antibody is Catalog # AAP34602 (Previous Catalog # AAPP23615)
Datasheets/Manuals Printable datasheet for anti-DMTF1 (ARP34602_P050) antibody
Publications

Yang, KC; Kitamura, Y; Wu, CC; Chang, HH; Ling, TY; Kuo, TF; Tooth Germ-Like Construct Transplantation for Whole-Tooth Regeneration: An In Vivo Study in the Miniature Pig. 40, E39-50 (2016). IHC, WB, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 26582651

Gene Symbol DMTF1
Official Gene Full Name cyclin D binding myb like transcription factor 1
Alias Symbols DMP1, DMTF, MRUL, hDMP1
NCBI Gene Id 9988
Protein Name cyclin-D-binding Myb-like transcription factor 1
Description of Target This gene encodes a transcription factor that contains a cyclin D-binding domain, three central Myb-like repeats, and two flanking acidic transactivation domains at the N- and C-termini. The encoded protein is induced by the oncogenic Ras signaling pathway and functions as a tumor suppressor by activating the transcription of ARF and thus the ARF-p53 pathway to arrest cell growth or induce apoptosis. It also activates the transcription of aminopeptidase N and may play a role in hematopoietic cell differentiation. The transcriptional activity of this protein is regulated by binding of D-cyclins. This gene is hemizygously deleted in approximately 40% of human non-small-cell lung cancer and is a potential prognostic and gene-therapy target for non-small-cell lung cancer. Multiple transcript variants encoding different isoforms have been found for this gene.
Swissprot Id Q9Y222
Protein Accession # EAW76962
Nucleotide Accession # NM_001142326
Protein Size (# AA) 494
Molecular Weight 54kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express DMTF1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express DMTF1.
Protein Interactions SRA1; TP53; ATF7IP; CCND1; CCND3; CCND2;
  1. What is the species homology for "DMTF1 Antibody - C-terminal region (ARP34602_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat".

  2. How long will it take to receive "DMTF1 Antibody - C-terminal region (ARP34602_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "DMTF1 Antibody - C-terminal region (ARP34602_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "DMTF1 Antibody - C-terminal region (ARP34602_P050)"?

    This target may also be called "DMP1, DMTF, MRUL, hDMP1" in publications.

  5. What is the shipping cost for "DMTF1 Antibody - C-terminal region (ARP34602_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "DMTF1 Antibody - C-terminal region (ARP34602_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "DMTF1 Antibody - C-terminal region (ARP34602_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "54kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "DMTF1 Antibody - C-terminal region (ARP34602_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "DMTF1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "DMTF1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "DMTF1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "DMTF1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "DMTF1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "DMTF1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:DMTF1 Antibody - C-terminal region (ARP34602_P050)
Your Rating
We found other products you might like!