Search Antibody, Protein, and ELISA Kit Solutions

DMTF1 Antibody - C-terminal region (ARP34602_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP34602_P050-FITC Conjugated

ARP34602_P050-HRP Conjugated

ARP34602_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
cyclin D binding myb like transcription factor 1
Protein Name:
cyclin-D-binding Myb-like transcription factor 1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-38068 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes a transcription factor that contains a cyclin D-binding domain, three central Myb-like repeats, and two flanking acidic transactivation domains at the N- and C-termini. The encoded protein is induced by the oncogenic Ras signaling pathway and functions as a tumor suppressor by activating the transcription of ARF and thus the ARF-p53 pathway to arrest cell growth or induce apoptosis. It also activates the transcription of aminopeptidase N and may play a role in hematopoietic cell differentiation. The transcriptional activity of this protein is regulated by binding of D-cyclins. This gene is hemizygously deleted in approximately 40% of human non-small-cell lung cancer and is a potential prognostic and gene-therapy target for non-small-cell lung cancer. Multiple transcript variants encoding different isoforms have been found for this gene.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express DMTF1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express DMTF1.
The immunogen is a synthetic peptide directed towards the C terminal region of human DMTF1
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Dog: 92%; Guinea Pig: 91%; Horse: 92%; Human: 100%; Mouse: 92%; Rabbit: 92%; Rat: 92%
Complete computational species homology data:
Anti-DMTF1 (ARP34602_P050)
Peptide Sequence:
Synthetic peptide located within the following region: SFNDAHVSKFSDQNSTELMNSVMVRTEEEISDTDLKQEESPSDLASAYVT
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-DMTF1 (ARP34602_P050) antibody is Catalog # AAP34602 (Previous Catalog # AAPP23615)
Printable datasheet for anti-DMTF1 (ARP34602_P050) antibody

Yang, KC; Kitamura, Y; Wu, CC; Chang, HH; Ling, TY; Kuo, TF; Tooth Germ-Like Construct Transplantation for Whole-Tooth Regeneration: An In Vivo Study in the Miniature Pig. 40, E39-50 (2016). IHC, WB, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 26582651

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...