Search Antibody, Protein, and ELISA Kit Solutions

DMRTC2 Antibody - N-terminal region (ARP36091_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP36091_P050-FITC Conjugated

ARP36091_P050-HRP Conjugated

ARP36091_P050-Biotin Conjugated

Gene Symbol:
DMRTC2
Official Gene Full Name:
DMRT-like family C2
NCBI Gene Id:
63946
Protein Name:
Doublesex- and mab-3-related transcription factor C2
Swissprot Id:
Q8IXT2
Protein Accession #:
NP_001035373
Nucleotide Accession #:
NM_001040283
Alias Symbols:
-
Replacement Item:
This antibody may replace item sc-131146 from Santa Cruz Biotechnology.
Description of Target:
DMRTC2 belongs to the DMRT family.It may be involved in sexual development.
Protein Size (# AA):
367
Molecular Weight:
39kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express DMRTC2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express DMRTC2.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human DMRTC2
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Human: 100%
Complete computational species homology data:
Anti-DMRTC2 (ARP36091_P050)
Peptide Sequence:
Synthetic peptide located within the following region: VLILERRRVMAAQVALRRQQEAQLKKHLMRRGEASPKAPNHFRKGTTQPQ
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
TXNRD1; IRF9;
Blocking Peptide:
For anti-DMRTC2 (ARP36091_P050) antibody is Catalog # AAP36091 (Previous Catalog # AAPP07419)
Datasheets/Manuals:
Printable datasheet for anti-DMRTC2 (ARP36091_P050) antibody
Target Reference:
Ottolenghi,C., (2002) Genomics 79 (3), 333-343

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...