Catalog No: ARP63397_P050
Price: $0.00
SKU
ARP63397_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-DMC1 (ARP63397_P050) antibody
Product Info
Tested Species ReactivityHuman, Mouse
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Pig, Rabbit, Yeast, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Goat: 92%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 100%; Yeast: 92%; Zebrafish: 93%
Peptide SequenceSynthetic peptide located within the following region: GIQMTTRRALCNVKGLSEAKVDKIKEAANKLIEPGFLTAFEYSEKRKMVF
Concentration0.5 mg/ml
Blocking PeptideFor anti-DMC1 (ARP63397_P050) antibody is Catalog # AAP63397
Gene SymbolDMC1
Gene Full NameDMC1 dosage suppressor of mck1 homolog, meiosis-specific homologous recombination (yeast)
Alias SymbolsDMC1H, LIM15, dJ199H16.1
NCBI Gene Id11144
Protein NameMeiotic recombination protein DMC1/LIM15 homolog
Description of TargetThe protein encoded by this gene is essential for meiotic homologous recombination. Genetic recombination in meiosis plays an important role in generating diversity of genetic information. The product of this gene is structurally and evolutionary related to the products of the yeast RAD51 and E. coli RecA genes. Alternative splice variants of this gene have been described but their full-length nature has not been determined.
Uniprot IDQ14565
Protein Accession #NP_008999
Nucleotide Accession #NM_007068
Protein Size (# AA)340
Molecular Weight37kDa
Protein InteractionsKCTD17; NIF3L1; GORASP2; DMC1; SDCBP; PSMA3; TRIM23; RAD51; BRCA2; RAD54B; RPA1; DNAJA3;
  1. What is the species homology for "DMC1 Antibody - N-terminal region (ARP63397_P050)"?

    The tested species reactivity for this item is "Human, Mouse". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Pig, Rabbit, Yeast, Zebrafish".

  2. How long will it take to receive "DMC1 Antibody - N-terminal region (ARP63397_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "DMC1 Antibody - N-terminal region (ARP63397_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "DMC1 Antibody - N-terminal region (ARP63397_P050)"?

    This target may also be called "DMC1H, LIM15, dJ199H16.1" in publications.

  5. What is the shipping cost for "DMC1 Antibody - N-terminal region (ARP63397_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "DMC1 Antibody - N-terminal region (ARP63397_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "DMC1 Antibody - N-terminal region (ARP63397_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "37kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "DMC1 Antibody - N-terminal region (ARP63397_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "DMC1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "DMC1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "DMC1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "DMC1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "DMC1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "DMC1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:DMC1 Antibody - N-terminal region (ARP63397_P050)
Your Rating
We found other products you might like!