SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP42352_P050-Biotin
Size:100ul
Price: $434.00
SKU
ARP42352_P050-Biotin
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

DMBT1 Antibody - N-terminal region : Biotin (ARP42352_P050-Biotin)

Datasheets/ManualsPrintable datasheet for anti-DMBT1 (ARP42352_P050-Biotin) antibody
Product Info
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationBiotin
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human DMBT1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceHuman: 100%
Peptide SequenceSynthetic peptide located within the following region: SWSTPSPDTLPTITLPASTVGSESSLALRLVNGGDRCQGRVEVLYRGSWG
Concentration0.5 mg/ml
Blocking PeptideFor anti-DMBT1 (ARP42352_P050-Biotin) antibody is Catalog # AAP42352 (Previous Catalog # AAPP12596)
Gene SymbolDMBT1
Gene Full NameDeleted in malignant brain tumors 1
Alias SymbolsSAG, GP340, SALSA, muclin
NCBI Gene Id1755
Protein NameDeleted in malignant brain tumors 1 protein
Description of TargetLoss of sequences from human chromosome 10q has been associated with the progression of human cancers. The gene DMBT1 was originally isolated based on its deletion in a medulloblastoma cell line. DMBT1 is expressed with transcripts of 6.0, 7.5, and 8.0 kb in fetal lung and with one transcript of 8.0 kb in adult lung, although the 7.5 kb transcript has not been characterized. The DMBT1 protein is a glycoprotein containing multiple scavenger receptor cysteine-rich (SRCR) domains separated by SRCR-interspersed domains (SID). Transcript variant 2 (8.0 kb) has been shown to bind surfactant protein D independently of carbohydrate recognition. This indicates that DMBT1 may not be a classical tumor supressor gene, but rather play a role in the interaction of tumor cells and the immune system.
Uniprot IDQ9UGM3
Protein Accession #NP_015568
Nucleotide Accession #NM_007329
Protein Size (# AA)2413
Molecular Weight258kDa
Protein InteractionsCDK6; COPS6; SUMO2; UBC; PARD6B; SFTPD; SFTPA1;
  1. What is the species homology for "DMBT1 Antibody - N-terminal region : Biotin (ARP42352_P050-Biotin)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "DMBT1 Antibody - N-terminal region : Biotin (ARP42352_P050-Biotin)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "DMBT1 Antibody - N-terminal region : Biotin (ARP42352_P050-Biotin)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "DMBT1 Antibody - N-terminal region : Biotin (ARP42352_P050-Biotin)"?

    This target may also be called "SAG, GP340, SALSA, muclin" in publications.

  5. What is the shipping cost for "DMBT1 Antibody - N-terminal region : Biotin (ARP42352_P050-Biotin)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "DMBT1 Antibody - N-terminal region : Biotin (ARP42352_P050-Biotin)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "DMBT1 Antibody - N-terminal region : Biotin (ARP42352_P050-Biotin)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "258kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "DMBT1 Antibody - N-terminal region : Biotin (ARP42352_P050-Biotin)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "DMBT1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "DMBT1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "DMBT1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "DMBT1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "DMBT1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "DMBT1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:DMBT1 Antibody - N-terminal region : Biotin (ARP42352_P050-Biotin)
Your Rating
We found other products you might like!