DMBT1 Antibody - N-terminal region (ARP42352_P050)

Catalog No: ARP42352_P050

Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.

WB Suggested Anti-DMBT1 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Stomach

Lanes:
Lane 1: 2ug MCF7-DMBT1+Dox
Lane 2: 2ug MCF7-DMBT1 -Dox
Lane 3: 2ug MCF7-Ctrl+Dox
Lane 4: 2ug MCF7-DMBT1 -Dox
Primary Antibody Dilution:
1:5000
Secondary Antibody:
Anti-rabbit HRP
Secondary Antibody Dilution:
1:10,000
Gene Name:
DMBT1
Submitted by:
Matthias Rauen, Lundbeckfonden Center of Excellence NanoCAN, University of Southern Denmark

Host: Rabbit
Target Name: DMBT1
Sample Tissue: Human Human Stomach
Antibody Dilution: 1ug/ml

Host: Rabbit
Target: DMBT1
Positive control (+): Human Lung (LU)
Negative control (-): HeLa Cell Lysate (HL)
Antibody concentration: 1ug/ml

Host: Rabbit
Target Name: DMBT1
Sample Tissue: Human HepG2 Whole Cell
Antibody Dilution: 3ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human DMBT1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Peptide Sequence: Synthetic peptide located within the following region: SWSTPSPDTLPTITLPASTVGSESSLALRLVNGGDRCQGRVEVLYRGSWG
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-DMBT1 (ARP42352_P050) antibody is Catalog # AAP42352 (Previous Catalog # AAPP12596)
• Publications:

  Gonzalez-Gil, A et al. Isolation, identification and characterization of the human airway ligand for the eosinophil and mast cell immunoinhibitory receptor SIGLEC-8. J Allergy Clin Immunol. 2020 Aug 10 S0091-6749 (20) 31107-6. 32791164

Target Info

• Gene Symbol: DMBT1
• Gene Full Name: Deleted in malignant brain tumors 1
• Alias Symbols: SAG, GP340, SALSA, muclin
• NCBI Gene Id: 1755
• Protein Name: Deleted in malignant brain tumors 1 protein
• Description of Target: Loss of sequences from human chromosome 10q has been associated with the progression of human cancers. The gene DMBT1 was originally isolated based on its deletion in a medulloblastoma cell line. DMBT1 is expressed with transcripts of 6.0, 7.5, and 8.0 kb in fetal lung and with one transcript of 8.0 kb in adult lung, although the 7.5 kb transcript has not been characterized. The DMBT1 protein is a glycoprotein containing multiple scavenger receptor cysteine-rich (SRCR) domains separated by SRCR-interspersed domains (SID). Transcript variant 2 (8.0 kb) has been shown to bind surfactant protein D independently of carbohydrate recognition. This indicates that DMBT1 may not be a classical tumor supressor gene, but rather play a role in the interaction of tumor cells and the immune system.
• Uniprot ID: Q9UGM3
• Protein Accession #: NP_015568
• Nucleotide Accession #: NM_007329
• Protein Size (# AA): 2413
• Molecular Weight: 258kDa
• Protein Interactions: CDK6; COPS6; SUMO2; UBC; PARD6B; SFTPD; SFTPA1;