Size:100 ul
$319.00
In Stock
SKU
ARP42352_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP42352_P050-FITC Conjugated

ARP42352_P050-HRP Conjugated

ARP42352_P050-Biotin Conjugated

DMBT1 Antibody - N-terminal region (ARP42352_P050)

Catalog#: ARP42352_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Human
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-14246 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human DMBT1
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Human: 100%
Complete computational species homology data Anti-DMBT1 (ARP42352_P050)
Peptide Sequence Synthetic peptide located within the following region: SWSTPSPDTLPTITLPASTVGSESSLALRLVNGGDRCQGRVEVLYRGSWG
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-DMBT1 (ARP42352_P050) antibody is Catalog # AAP42352 (Previous Catalog # AAPP12596)
Datasheets/Manuals Printable datasheet for anti-DMBT1 (ARP42352_P050) antibody
Publications

Gonzalez-Gil, A et al. Isolation, identification and characterization of the human airway ligand for the eosinophil and mast cell immunoinhibitory receptor SIGLEC-8. J Allergy Clin Immunol. 2020 Aug 10; S0091-6749 (20) 31107-6. WB, Human 32791164

Gene Symbol DMBT1
Official Gene Full Name Deleted in malignant brain tumors 1
Alias Symbols GP340, MGC164738, muclin
NCBI Gene Id 1755
Protein Name Deleted in malignant brain tumors 1 protein
Description of Target Loss of sequences from human chromosome 10q has been associated with the progression of human cancers. The gene DMBT1 was originally isolated based on its deletion in a medulloblastoma cell line. DMBT1 is expressed with transcripts of 6.0, 7.5, and 8.0 kb in fetal lung and with one transcript of 8.0 kb in adult lung, although the 7.5 kb transcript has not been characterized. The DMBT1 protein is a glycoprotein containing multiple scavenger receptor cysteine-rich (SRCR) domains separated by SRCR-interspersed domains (SID). Transcript variant 2 (8.0 kb) has been shown to bind surfactant protein D independently of carbohydrate recognition. This indicates that DMBT1 may not be a classical tumor supressor gene, but rather play a role in the interaction of tumor cells and the immune system.
Swissprot Id Q9UGM3
Protein Accession # NP_015568
Nucleotide Accession # NM_007329
Protein Size (# AA) 2413
Molecular Weight 258kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express DMBT1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express DMBT1.
Protein Interactions CDK6; COPS6; SUMO2; UBC; PARD6B; SFTPD; SFTPA1;
  1. What is the species homology for "DMBT1 Antibody - N-terminal region (ARP42352_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "DMBT1 Antibody - N-terminal region (ARP42352_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "DMBT1 Antibody - N-terminal region (ARP42352_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "DMBT1 Antibody - N-terminal region (ARP42352_P050)"?

    This target may also be called "GP340, MGC164738, muclin" in publications.

  5. What is the shipping cost for "DMBT1 Antibody - N-terminal region (ARP42352_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "DMBT1 Antibody - N-terminal region (ARP42352_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "DMBT1 Antibody - N-terminal region (ARP42352_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "258kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "DMBT1 Antibody - N-terminal region (ARP42352_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "DMBT1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "DMBT1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "DMBT1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "DMBT1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "DMBT1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "DMBT1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:DMBT1 Antibody - N-terminal region (ARP42352_P050)
Your Rating
We found other products you might like!