Search Antibody, Protein, and ELISA Kit Solutions

DMBT1 Antibody - N-terminal region (ARP42352_P050)

100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP42352_P050-FITC Conjugated

ARP42352_P050-HRP Conjugated

ARP42352_P050-Biotin Conjugated

Gene Symbol:
DMBT1
Official Gene Full Name:
Deleted in malignant brain tumors 1
NCBI Gene Id:
1755
Protein Name:
Deleted in malignant brain tumors 1 protein
Swissprot Id:
Q9UGM3
Protein Accession #:
NP_015568
Nucleotide Accession #:
NM_007329
Alias Symbols:
GP340, MGC164738, muclin
Replacement Item:
This antibody may replace item sc-14246 from Santa Cruz Biotechnology.
Description of Target:
Loss of sequences from human chromosome 10q has been associated with the progression of human cancers. The gene DMBT1 was originally isolated based on its deletion in a medulloblastoma cell line. DMBT1 is expressed with transcripts of 6.0, 7.5, and 8.0 kb in fetal lung and with one transcript of 8.0 kb in adult lung, although the 7.5 kb transcript has not been characterized. The DMBT1 protein is a glycoprotein containing multiple scavenger receptor cysteine-rich (SRCR) domains separated by SRCR-interspersed domains (SID). Transcript variant 2 (8.0 kb) has been shown to bind surfactant protein D independently of carbohydrate recognition. This indicates that DMBT1 may not be a classical tumor supressor gene, but rather play a role in the interaction of tumor cells and the immune system.
Protein Size (# AA):
2413
Molecular Weight:
258kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express DMBT1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express DMBT1.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human DMBT1
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Human: 100%
Complete computational species homology data:
Anti-DMBT1 (ARP42352_P050)
Peptide Sequence:
Synthetic peptide located within the following region: SWSTPSPDTLPTITLPASTVGSESSLALRLVNGGDRCQGRVEVLYRGSWG
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
CDK6; COPS6; SUMO2; UBC; PARD6B; SFTPD; SFTPA1;
Blocking Peptide:
For anti-DMBT1 (ARP42352_P050) antibody is Catalog # AAP42352 (Previous Catalog # AAPP12596)
Datasheets/Manuals:
Printable datasheet for anti-DMBT1 (ARP42352_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...