Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP35763_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP35763_P050-FITC Conjugated

ARP35763_P050-HRP Conjugated

ARP35763_P050-Biotin Conjugated

Dlx6 Antibody - C-terminal region (ARP35763_P050)

Catalog#: ARP35763_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species ReactivityRat
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-18154 from Santa Cruz Biotechnology.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Complete computational species homology dataAnti-Dlx6 (ARP35763_P050)
Peptide SequenceSynthetic peptide located within the following region: FQQTQYLALPERAELAASLGLTQTQVKIWFQNKRSKFKKLLKQGSNPHES
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-Dlx6 (ARP35763_P050) antibody is Catalog # AAP35763 (Previous Catalog # AAPP07015)
Datasheets/ManualsPrintable datasheet for anti-Dlx6 (ARP35763_P050) antibody
Publications

Li, H. et al. Expression and function of Dlx genes in the osteoblast lineage. Dev. Biol. 316, 458-70 (2008). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 18280462

Gene SymbolDlx6
Official Gene Full NameDistal-less homeobox 6
Alias SymbolsRGD1561539
NCBI Gene Id500023
Description of TargetThe function of this protein remains unknown.
Protein Accession #XP_575377
Nucleotide Accession #XM_575377
Protein Size (# AA)268
Molecular Weight30kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express Dlx6.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express Dlx6.
  1. What is the species homology for "Dlx6 Antibody - C-terminal region (ARP35763_P050)"?

    The tested species reactivity for this item is "Rat". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish".

  2. How long will it take to receive "Dlx6 Antibody - C-terminal region (ARP35763_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "Dlx6 Antibody - C-terminal region (ARP35763_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "Dlx6 Antibody - C-terminal region (ARP35763_P050)"?

    This target may also be called "RGD1561539" in publications.

  5. What is the shipping cost for "Dlx6 Antibody - C-terminal region (ARP35763_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "Dlx6 Antibody - C-terminal region (ARP35763_P050)"?

    All Aviva products have been through vigorous validations and carry 100% satisfaction warranty.

  7. Can I get bulk pricing for "Dlx6 Antibody - C-terminal region (ARP35763_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "30kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "Dlx6 Antibody - C-terminal region (ARP35763_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "DLX6"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "DLX6"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "DLX6"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "DLX6"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "DLX6"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "DLX6"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:Dlx6 Antibody - C-terminal region (ARP35763_P050)
Your Rating
Aviva HIS tag Deal
Aviva ChIP Antibodies
Aviva Live Chat
Aviva Tissue Tool