Aviva Systems Biology office will be closed for Good Friday - April 19, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

Dlx6 Antibody - C-terminal region (ARP35763_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP35763_P050-FITC Conjugated

ARP35763_P050-HRP Conjugated

ARP35763_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Distal-less homeobox 6
NCBI Gene Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-18154 from Santa Cruz Biotechnology.
Description of Target:
The function of this protein remains unknown.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express Dlx6.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express Dlx6.
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Complete computational species homology data:
Anti-Dlx6 (ARP35763_P050)
Peptide Sequence:
Synthetic peptide located within the following region: FQQTQYLALPERAELAASLGLTQTQVKIWFQNKRSKFKKLLKQGSNPHES
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-Dlx6 (ARP35763_P050) antibody is Catalog # AAP35763 (Previous Catalog # AAPP07015)
Printable datasheet for anti-Dlx6 (ARP35763_P050) antibody

Li, H. et al. Expression and function of Dlx genes in the osteoblast lineage. Dev. Biol. 316, 458-70 (2008). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 18280462

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...