Search Antibody, Protein, and ELISA Kit Solutions

Dlx6 antibody - C-terminal region (ARP35763_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP35763_P050-FITC Conjugated

ARP35763_P050-HRP Conjugated

ARP35763_P050-Biotin Conjugated

Gene Symbol:
Dlx6
NCBI Gene Id:
500023
Official Gene Full Name:
Distal-less homeobox 6
Protein Accession #:
XP_575377
Nucleotide Accession #:
XM_575377
Alias Symbols:
RGD1561539
Replacement Item:
This antibody may replace item sc-18154 from Santa Cruz Biotechnology.
Description of Target:
The function of this protein remains unknown.
Protein Size (# AA):
268
Molecular Weight:
30kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express Dlx6.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express Dlx6.
Tested Species Reactivity:
Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Complete computational species homology data:
Anti-Dlx6 (ARP35763_P050)
Peptide Sequence:
Synthetic peptide located within the following region: FQQTQYLALPERAELAASLGLTQTQVKIWFQNKRSKFKKLLKQGSNPHES
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-Dlx6 (ARP35763_P050) antibody is Catalog # AAP35763 (Previous Catalog # AAPP07015)
Datasheets/Manuals:
Printable datasheet for anti-Dlx6 (ARP35763_P050) antibody
Publications:

Li, H. et al. Expression and function of Dlx genes in the osteoblast lineage. Dev. Biol. 316, 458-70 (2008). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 18280462

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...