Search Antibody, Protein, and ELISA Kit Solutions

DLX4 Antibody - middle region (ARP84704_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Gene Symbol:
DLX4
Official Gene Full Name:
distal-less homeobox 4
NCBI Gene Id:
1748
Protein Name:
homeobox protein DLX-4
Swissprot Id:
Q92988
Protein Accession #:
NP_001925.2
Nucleotide Accession #:
NM_001934.3
Alias Symbols:
BP1, DLX7, DLX8, DLX9
Description of Target:
Many vertebrate homeo box-containing genes have been identified on the basis of their sequence similarity with Drosophila developmental genes. Members of the Dlx gene family contain a homeobox that is related to that of Distal-less (Dll), a gene expressed in the head and limbs of the developing fruit fly. The Distal-less (Dlx) family of genes comprises at least 6 different members, DLX1-DLX6. The DLX proteins are postulated to play a role in forebrain and craniofacial development. Three transcript variants have been described for this gene, however, the full length nature of one variant has not been described. Studies of the two splice variants revealed that one encoded isoform functions as a repressor of the beta-globin gene while the other isoform lacks that function.
Protein Size (# AA):
240
Molecular Weight:
26 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express DLX4.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express DLX4.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle terminal region of human DLX4
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: LPERAQLAAQLGLTQTQVKIWFQNKRSKYKKLLKQNSGGQEGDFPGRTFS
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-DLX4 (ARP84704_P050) antibody is Catalog # AAP84704
Datasheets/Manuals:
Printable datasheet for anti-DLX4 (ARP84704_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...