Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
SKU
ARP32866_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP32866_P050-FITC Conjugated

ARP32866_P050-HRP Conjugated

ARP32866_P050-Biotin Conjugated

DLX1 Antibody - C-terminal region (ARP32866_P050)

Catalog#: ARP32866_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-324846 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human DLX1
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Complete computational species homology data Anti-DLX1 (ARP32866_P050)
Peptide Sequence Synthetic peptide located within the following region: KFKKLMKQGGAALEGSALANGRALSAGSPPVPPGWNPNSSSGKGSGGNAG
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-DLX1 (ARP32866_P050) antibody is Catalog # AAP32866 (Previous Catalog # AAPP03886)
Datasheets/Manuals Printable datasheet for anti-DLX1 (ARP32866_P050) antibody
Target Reference Kahler,A.K., (er) Am. J. Med. Genet. B Neuropsychiatr. Genet. (2008) In press
Publications

Bökenkamp, R. et al. Dlx1 and Rgs5 in the ductus arteriosus: vessel-specific genes identified by transcriptional profiling of laser-capture microdissected endothelial and smooth muscle cells. PLoS One 9, e86892 (2014). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 24489801

Gene Symbol DLX1
Official Gene Full Name Distal-less homeobox 1
Alias Symbols -
NCBI Gene Id 1745
Protein Name Homeobox protein DLX-1
Description of Target DLX1 is a member of a homeobox transcription factor family. It is localized to the nucleus where it may function as a transcriptional regulator of signals from multiple TGF-{beta} superfamily members. DLX1 may play a role in the control of craniofacial patterning and the differentiation and survival of inhibitory neurons in the forebrain.This gene encodes a member of a homeobox transcription factor gene family similiar to the Drosophila distal-less gene. The encoded protein is localized to the nucleus where it may function as a transcriptional regulator of signals from multiple TGF-{beta} superfamily members. The encoded protein may play a role in the control of craniofacial patterning and the differentiation and survival of inhibitory neurons in the forebrain. This gene is located in a tail-to-tail configuration with another member of the family on the long arm of chromosome 2. Alternatively spliced transcript variants encoding different isoforms have been described.
Swissprot Id P56177
Protein Accession # NP_835221
Nucleotide Accession # NM_178120
Protein Size (# AA) 255
Molecular Weight 27kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express DLX1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express DLX1.
Protein Interactions SMAD4;
Write Your Own Review
You're reviewing:DLX1 Antibody - C-terminal region (ARP32866_P050)
Your Rating