Catalog No: ARP32866_P050
Price: $0.00
SKU
ARP32866_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-DLX1 (ARP32866_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human DLX1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: KFKKLMKQGGAALEGSALANGRALSAGSPPVPPGWNPNSSSGKGSGGNAG
Concentration0.5 mg/ml
Blocking PeptideFor anti-DLX1 (ARP32866_P050) antibody is Catalog # AAP32866 (Previous Catalog # AAPP03886)
ReferenceKahler,A.K., (er) Am. J. Med. Genet. B Neuropsychiatr. Genet. (2008) In press
Publications

Bökenkamp, R. et al. Dlx1 and Rgs5 in the ductus arteriosus: vessel-specific genes identified by transcriptional profiling of laser-capture microdissected endothelial and smooth muscle cells. PLoS One 9, e86892 (2014). 24489801

Gene SymbolDLX1
Gene Full NameDistal-less homeobox 1
Alias Symbols-
NCBI Gene Id1745
Protein NameHomeobox protein DLX-1
Description of TargetDLX1 is a member of a homeobox transcription factor family. It is localized to the nucleus where it may function as a transcriptional regulator of signals from multiple TGF-{beta} superfamily members. DLX1 may play a role in the control of craniofacial patterning and the differentiation and survival of inhibitory neurons in the forebrain.This gene encodes a member of a homeobox transcription factor gene family similiar to the Drosophila distal-less gene. The encoded protein is localized to the nucleus where it may function as a transcriptional regulator of signals from multiple TGF-{beta} superfamily members. The encoded protein may play a role in the control of craniofacial patterning and the differentiation and survival of inhibitory neurons in the forebrain. This gene is located in a tail-to-tail configuration with another member of the family on the long arm of chromosome 2. Alternatively spliced transcript variants encoding different isoforms have been described.
Uniprot IDP56177
Protein Accession #NP_835221
Nucleotide Accession #NM_178120
Protein Size (# AA)255
Molecular Weight27kDa
Protein InteractionsSMAD4;
  1. What is the species homology for "DLX1 Antibody - C-terminal region (ARP32866_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "DLX1 Antibody - C-terminal region (ARP32866_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "DLX1 Antibody - C-terminal region (ARP32866_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "DLX1 Antibody - C-terminal region (ARP32866_P050)"?

    This target may also be called "-" in publications.

  5. What is the shipping cost for "DLX1 Antibody - C-terminal region (ARP32866_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "DLX1 Antibody - C-terminal region (ARP32866_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "DLX1 Antibody - C-terminal region (ARP32866_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "27kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "DLX1 Antibody - C-terminal region (ARP32866_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "DLX1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "DLX1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "DLX1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "DLX1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "DLX1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "DLX1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:DLX1 Antibody - C-terminal region (ARP32866_P050)
Your Rating
We found other products you might like!