Search Antibody, Protein, and ELISA Kit Solutions

DLX1 Antibody - C-terminal region (ARP32866_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP32866_P050-FITC Conjugated

ARP32866_P050-HRP Conjugated

ARP32866_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-324846 from Santa Cruz Biotechnology.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human DLX1
Purification:
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Complete computational species homology data:
Anti-DLX1 (ARP32866_P050)
Peptide Sequence:
Synthetic peptide located within the following region: KFKKLMKQGGAALEGSALANGRALSAGSPPVPPGWNPNSSSGKGSGGNAG
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-DLX1 (ARP32866_P050) antibody is Catalog # AAP32866 (Previous Catalog # AAPP03886)
Datasheets/Manuals:
Printable datasheet for anti-DLX1 (ARP32866_P050) antibody
Target Reference:
Kahler,A.K., (er) Am. J. Med. Genet. B Neuropsychiatr. Genet. (2008) In press
Publications:

Bökenkamp, R. et al. Dlx1 and Rgs5 in the ductus arteriosus: vessel-specific genes identified by transcriptional profiling of laser-capture microdissected endothelial and smooth muscle cells. PLoS One 9, e86892 (2014). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 24489801

Gene Symbol:
DLX1
Official Gene Full Name:
Distal-less homeobox 1
Alias Symbols:
-
NCBI Gene Id:
1745
Protein Name:
Homeobox protein DLX-1
Description of Target:
DLX1 is a member of a homeobox transcription factor family. It is localized to the nucleus where it may function as a transcriptional regulator of signals from multiple TGF-{beta} superfamily members. DLX1 may play a role in the control of craniofacial patterning and the differentiation and survival of inhibitory neurons in the forebrain.This gene encodes a member of a homeobox transcription factor gene family similiar to the Drosophila distal-less gene. The encoded protein is localized to the nucleus where it may function as a transcriptional regulator of signals from multiple TGF-{beta} superfamily members. The encoded protein may play a role in the control of craniofacial patterning and the differentiation and survival of inhibitory neurons in the forebrain. This gene is located in a tail-to-tail configuration with another member of the family on the long arm of chromosome 2. Alternatively spliced transcript variants encoding different isoforms have been described.
Swissprot Id:
P56177
Protein Accession #:
NP_835221
Nucleotide Accession #:
NM_178120
Protein Size (# AA):
255
Molecular Weight:
27kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express DLX1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express DLX1.
Protein Interactions:
SMAD4;

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...