Search Antibody, Protein, and ELISA Kit Solutions

DLX1 Antibody - C-terminal region (ARP32866_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP32866_P050-FITC Conjugated

ARP32866_P050-HRP Conjugated

ARP32866_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
Distal-less homeobox 1
NCBI Gene Id:
Protein Name:
Homeobox protein DLX-1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-324846 from Santa Cruz Biotechnology.
Description of Target:
DLX1 is a member of a homeobox transcription factor family. It is localized to the nucleus where it may function as a transcriptional regulator of signals from multiple TGF-{beta} superfamily members. DLX1 may play a role in the control of craniofacial patterning and the differentiation and survival of inhibitory neurons in the forebrain.This gene encodes a member of a homeobox transcription factor gene family similiar to the Drosophila distal-less gene. The encoded protein is localized to the nucleus where it may function as a transcriptional regulator of signals from multiple TGF-{beta} superfamily members. The encoded protein may play a role in the control of craniofacial patterning and the differentiation and survival of inhibitory neurons in the forebrain. This gene is located in a tail-to-tail configuration with another member of the family on the long arm of chromosome 2. Alternatively spliced transcript variants encoding different isoforms have been described.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express DLX1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express DLX1.
The immunogen is a synthetic peptide directed towards the C terminal region of human DLX1
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Complete computational species homology data:
Anti-DLX1 (ARP32866_P050)
Peptide Sequence:
Synthetic peptide located within the following region: KFKKLMKQGGAALEGSALANGRALSAGSPPVPPGWNPNSSSGKGSGGNAG
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-DLX1 (ARP32866_P050) antibody is Catalog # AAP32866 (Previous Catalog # AAPP03886)
Printable datasheet for anti-DLX1 (ARP32866_P050) antibody
Target Reference:
Kahler,A.K., (er) Am. J. Med. Genet. B Neuropsychiatr. Genet. (2008) In press

Bökenkamp, R. et al. Dlx1 and Rgs5 in the ductus arteriosus: vessel-specific genes identified by transcriptional profiling of laser-capture microdissected endothelial and smooth muscle cells. PLoS One 9, e86892 (2014). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 24489801

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...