Catalog No: OPCA03294
Price: $0.00
SKU
OPCA03294
Availability: Domestic: Antibody & Kits: 2 weeks | Proteins: 4-6 weeks | International: Antibody & Kits: 2 weeks | Proteins: 4-6 weeks
Contact Us:
- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
Shipping Info:
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for DLK2 Recombinant Protein (Mouse) (OPCA03294) (OPCA03294) |
---|
Predicted Species Reactivity | Mouse|Mus musculus |
---|---|
Product Format | Liquid or Lyophilized powder |
Host | Mouse |
Additional Information | Relevance: Regulates adipogenesis. |
Reconstitution and Storage | -20°C or -80°C |
Formulation | 20 mM Tris-HCl based buffer, pH 8.0 |
Purity | Greater than 90% as determined by SDS-PAGE. |
Peptide Sequence | DDCSSHCDLAHGCCAPDGSCRCDPGWEGLHCERCVRMPGCQHGTCHQPWQCICHSGWAGKFCDKDEHICTSQSPCQNGGQCVYDGGGEYHCVCLPGFHGRGCERKAGPCEQAGFPCRNGGQCQDNQGFALNFTCRCLAGFMGAHCEVNVDDCLMRPCANGATCIDGINRFSCLCPEGFAGRFCTINLDDCASRPCQRGARCRDRVHDFDCLCPSGYGGKTCELVLPAPEPASVGTPQMPTSAVVVPATGPAPHSAGAGLLRISVKEVVRRQESGLGESS |
Protein Sequence | DDCSSHCDLAHGCCAPDGSCRCDPGWEGLHCERCVRMPGCQHGTCHQPWQCICHSGWAGKFCDKDEHICTSQSPCQNGGQCVYDGGGEYHCVCLPGFHGRGCERKAGPCEQAGFPCRNGGQCQDNQGFALNFTCRCLAGFMGAHCEVNVDDCLMRPCANGATCIDGINRFSCLCPEGFAGRFCTINLDDCASRPCQRGARCRDRVHDFDCLCPSGYGGKTCELVLPAPEPASVGTPQMPTSAVVVPATGPAPHSAGAGLLRISVKEVVRRQESGLGESS |
Storage Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Source | Yeast |
Protein Range | 27-305 aa |
Tag | N-terminal 6xHis-tagged |
Reference | The novel gene EGFL9/Dlk2, highly homologous to Dlk1, functions as a modulator of adipogenesis.Nueda M.L., Baladron V., Garcia-Ramirez J.J., Sanchez-Solana B., Ruvira M.D., Rivero S., Ballesteros M.A., Monsalve E.M., Diaz-Guerra M.J., Ruiz-Hidalgo M.J., Laborda J.J. Mol. Biol. 367:1270-1280(2007) |
---|---|
Gene Symbol | Dlk2 |
Gene Full Name | delta like non-canonical Notch ligand 2 |
Alias Symbols | AI413481;delta-like 2 homolog;DLK-2;Egfl;Egfl9;EGF-like protein 9;EGF-like-domain, multiple 9;endothelial cell-specific protein S-1;epidermal growth factor-like protein 9;protein delta homolog 2. |
NCBI Gene Id | 106565 |
Protein Name | Protein delta homolog 2 |
Description of Target | Regulates adipogenesis. |
Uniprot ID | Q8K1E3 |
Protein Accession # | NP_001272942.1 |
Nucleotide Accession # | NM_001286013.1 |
Protein Size (# AA) | Recombinant |
Molecular Weight | 31.6 kDa |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
Write Your Own Review
We found other products you might like!