Size:100 ul
Special Price $229.00 Regular Price $319.00
In stock
SKU
ARP49784_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP49784_P050-FITC Conjugated

ARP49784_P050-HRP Conjugated

ARP49784_P050-Biotin Conjugated

Dlk2 Antibody - C-terminal region (ARP49784_P050)

Catalog#: ARP49784_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Mouse
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-111975 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Dlk2
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 86%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 93%; Rat: 93%
Peptide Sequence Synthetic peptide located within the following region: LVLPAPEPASVGTPQMPTSAVVVPATGPAPHSAGAGLLRISVKEVVRRQE
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-Dlk2 (ARP49784_P050) antibody is Catalog # AAP49784
Datasheets/Manuals Printable datasheet for anti-Dlk2 (ARP49784_P050) antibody
Publications

Fabian, KP; Chi-Sabins, N; Taylor, JL; Fecek, R; Weinstein, A; Storkus, WJ; Therapeutic efficacy of combined vaccination against tumor pericyte-associated antigens DLK1 and DLK2 in mice. 6, e1290035 (2017). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat 28405524

Gene Symbol Dlk2
Official Gene Full Name delta-like 2 homolog (Drosophila)
Alias Symbols AI413481, Egfl9
NCBI Gene Id 106565
Protein Name Protein delta homolog 2
Description of Target Dlk2 regulates adipogenesis.
Swissprot Id Q8K1E3-3
Protein Accession # NP_997549
Nucleotide Accession # NM_207666
Protein Size (# AA) 425
Molecular Weight 45kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express Dlk2.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express Dlk2.
Write Your Own Review
You're reviewing:Dlk2 Antibody - C-terminal region (ARP49784_P050)
Your Rating