Search Antibody, Protein, and ELISA Kit Solutions

Dlk2 Antibody - C-terminal region (ARP49784_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP49784_P050-FITC Conjugated

ARP49784_P050-HRP Conjugated

ARP49784_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
delta-like 2 homolog (Drosophila)
NCBI Gene Id:
Protein Name:
Protein delta homolog 2
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
AI413481, Egfl9
Replacement Item:
This antibody may replace item sc-111975 from Santa Cruz Biotechnology.
Description of Target:
Dlk2 regulates adipogenesis.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express Dlk2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express Dlk2.
The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Dlk2
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 86%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 93%; Rat: 93%
Peptide Sequence:
Synthetic peptide located within the following region: LVLPAPEPASVGTPQMPTSAVVVPATGPAPHSAGAGLLRISVKEVVRRQE
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-Dlk2 (ARP49784_P050) antibody is Catalog # AAP49784
Printable datasheet for anti-Dlk2 (ARP49784_P050) antibody

Fabian, KP; Chi-Sabins, N; Taylor, JL; Fecek, R; Weinstein, A; Storkus, WJ; Therapeutic efficacy of combined vaccination against tumor pericyte-associated antigens DLK1 and DLK2 in mice. 6, e1290035 (2017). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat 28405524

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...