Search Antibody, Protein, and ELISA Kit Solutions

Dlk2 Antibody - C-terminal region (ARP49784_P050)

100 ul

Regular Price: $319.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP49784_P050-FITC Conjugated

ARP49784_P050-HRP Conjugated

ARP49784_P050-Biotin Conjugated

Tested Species Reactivity:
Mouse
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-111975 from Santa Cruz Biotechnology.
Immunogen:
The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Dlk2
Purification:
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 86%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 93%; Rat: 93%
Peptide Sequence:
Synthetic peptide located within the following region: LVLPAPEPASVGTPQMPTSAVVVPATGPAPHSAGAGLLRISVKEVVRRQE
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-Dlk2 (ARP49784_P050) antibody is Catalog # AAP49784
Datasheets/Manuals:
Printable datasheet for anti-Dlk2 (ARP49784_P050) antibody
Publications:

Fabian, KP; Chi-Sabins, N; Taylor, JL; Fecek, R; Weinstein, A; Storkus, WJ; Therapeutic efficacy of combined vaccination against tumor pericyte-associated antigens DLK1 and DLK2 in mice. 6, e1290035 (2017). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat 28405524

Gene Symbol:
Dlk2
Official Gene Full Name:
delta-like 2 homolog (Drosophila)
Alias Symbols:
AI413481, Egfl9
NCBI Gene Id:
106565
Protein Name:
Protein delta homolog 2
Description of Target:
Dlk2 regulates adipogenesis.
Swissprot Id:
Q8K1E3-3
Protein Accession #:
NP_997549
Nucleotide Accession #:
NM_207666
Protein Size (# AA):
425
Molecular Weight:
45kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express Dlk2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express Dlk2.

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...