Search Antibody, Protein, and ELISA Kit Solutions

DLD Antibody - middle region (ARP58455_P050)

100 ul

Regular Price: $319.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP58455_P050-FITC Conjugated

ARP58455_P050-HRP Conjugated

ARP58455_P050-Biotin Conjugated

Tested Species Reactivity:
Human, Rat
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-119779 from Santa Cruz Biotechnology.
The immunogen is a synthetic peptide directed towards the middle region of human DLD
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 86%; Rabbit: 100%; Rat: 93%; Yeast: 86%; Zebrafish: 93%
Complete computational species homology data:
Anti-DLD (ARP58455_P050)
Peptide Sequence:
Synthetic peptide located within the following region: AGEMVNEAALALEYGASCEDIARVCHAHPTLSEAFREANLAASFGKSINF
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-DLD (ARP58455_P050) antibody is Catalog # AAP58455 (Previous Catalog # AAPP34562)
Printable datasheet for anti-DLD (ARP58455_P050) antibody
Sample Type Confirmation:

DLD is supported by BioGPS gene expression data to be expressed in HeLa, Jurkat, MCF7

Target Reference:
Wang,Y.C., (2008) J. Biomed. Sci. 15 (1), 37-46
Gene Symbol:
Official Gene Full Name:
Dihydrolipoamide dehydrogenase
Alias Symbols:
NCBI Gene Id:
Protein Name:
Dihydrolipoyl dehydrogenase, mitochondrial
Description of Target:
DLD is the L protein of the mitochondrial glycine cleavage system. The L protein, also named dihydrolipoamide dehydrogenase, is also a component of the pyruvate dehydrogenase complex, the alpha-ketoglutarate dehydrogenase complex, and the branched-chain alpha-keto acide dehydrogenase complex. Mutations in this gene have been identified in patients with E3-deficient maple syrup urine disease and lipoamide dehydrogenase deficiency.This gene encodes the L protein of the mitochondrial glycine cleavage system. The L protein, also named dihydrolipoamide dehydrogenase, is also a component of the pyruvate dehydrogenase complex, the alpha-ketoglutarate dehydrogenase complex, and the branched-chain alpha-keto acide dehydrogenase complex. Mutations in this gene have been identified in patients with E3-deficient maple syrup urine disease and lipoamide dehydrogenase deficiency. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Size (# AA):
Molecular Weight:
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express DLD.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express DLD.
Protein Interactions:

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...