Loading...
Catalog No: ARP58455_P050
Price: $0.00
SKU
ARP58455_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-DLD (ARP58455_P050) antibody
Product Info
Tested Species ReactivityHuman, Rat
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human DLD
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 86%; Rabbit: 100%; Rat: 93%; Yeast: 86%; Zebrafish: 93%
Peptide SequenceSynthetic peptide located within the following region: AGEMVNEAALALEYGASCEDIARVCHAHPTLSEAFREANLAASFGKSINF
Concentration0.5 mg/ml
Blocking PeptideFor anti-DLD (ARP58455_P050) antibody is Catalog # AAP58455 (Previous Catalog # AAPP34562)
Sample Type Confirmation

DLD is supported by BioGPS gene expression data to be expressed in HeLa, Jurkat, MCF7

ReferenceWang,Y.C., (2008) J. Biomed. Sci. 15 (1), 37-46
Gene SymbolDLD
Gene Full NameDihydrolipoamide dehydrogenase
Alias SymbolsE3, LAD, DLDD, DLDH, GCSL, PHE3, OGDC-E3
NCBI Gene Id1738
Protein NameDihydrolipoyl dehydrogenase, mitochondrial
Description of TargetDLD is the L protein of the mitochondrial glycine cleavage system. The L protein, also named dihydrolipoamide dehydrogenase, is also a component of the pyruvate dehydrogenase complex, the alpha-ketoglutarate dehydrogenase complex, and the branched-chain alpha-keto acide dehydrogenase complex. Mutations in this gene have been identified in patients with E3-deficient maple syrup urine disease and lipoamide dehydrogenase deficiency.This gene encodes the L protein of the mitochondrial glycine cleavage system. The L protein, also named dihydrolipoamide dehydrogenase, is also a component of the pyruvate dehydrogenase complex, the alpha-ketoglutarate dehydrogenase complex, and the branched-chain alpha-keto acide dehydrogenase complex. Mutations in this gene have been identified in patients with E3-deficient maple syrup urine disease and lipoamide dehydrogenase deficiency. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Uniprot IDB2R5X0
Protein Accession #NP_000099
Nucleotide Accession #NM_000108
Protein Size (# AA)509
Molecular Weight54 kDa
Protein InteractionsHUWE1; FUS; UBC; SUMO1; NEDD8; MDM2; ASB15; PEPD; LDHA; CKB; ASS1; CNDP2; TNFAIP8; DPP3; RPL23; FN1; ATF2; MRPL11; UBAP2; MRPL37; MRPL13; MRPL42; GGH; UQCRC2; UQCRC1; MRPL23; NONO; NDUFB5; NDUFA9; ETFB; DLAT; DBT; AK2; SIRT7; SLC2A4; PSMD4; OGDH; DLD; PDH
  1. What is the species homology for "DLD Antibody - middle region (ARP58455_P050)"?

    The tested species reactivity for this item is "Human, Rat". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish".

  2. How long will it take to receive "DLD Antibody - middle region (ARP58455_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "DLD Antibody - middle region (ARP58455_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "DLD Antibody - middle region (ARP58455_P050)"?

    This target may also be called "E3, LAD, DLDD, DLDH, GCSL, PHE3, OGDC-E3" in publications.

  5. What is the shipping cost for "DLD Antibody - middle region (ARP58455_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "DLD Antibody - middle region (ARP58455_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "DLD Antibody - middle region (ARP58455_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "54 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "DLD Antibody - middle region (ARP58455_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "DLD"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "DLD"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "DLD"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "DLD"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "DLD"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "DLD"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:DLD Antibody - middle region (ARP58455_P050)
Your Rating