Size:100 ul
In Stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP47163_P050 Unconjugated

ARP47163_P050-FITC Conjugated

ARP47163_P050-Biotin Conjugated

DKFZP564J0863 Antibody - middle region : HRP (ARP47163_P050-HRP)

Catalog#: ARP47163_P050-HRP
Domestic: within 1-2 days delivery | International: 1-2 days
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Clonality Polyclonal
Host Rabbit
Conjugation HRP
Application WB
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human DKFZP564J0863
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Complete computational species homology data Anti-DKFZP564J0863 (ARP47163_P050)
Peptide Sequence Synthetic peptide located within the following region: DHFKKTKKMGGKDFSFRYQQELEEEIKELYENFCKHNGSKNVFSTFRTPA
Concentration 0.5 mg/ml
Blocking Peptide For anti-ATL3 (ARP47163_P050-HRP) antibody is Catalog # AAP47163 (Previous Catalog # AAPP27936)
Datasheets/Manuals Printable datasheet for anti-ATL3 (ARP47163_P050-HRP) antibody
Target Reference Dias (2000) Proc. Natl. Acad. Sci. U.S.A. 97 (7), 3491-3496

Polisetty, R. V. et al. LC-MS/MS Analysis of Differentially Expressed Glioblastoma Membrane Proteome Reveals Altered Calcium Signaling and Other Protein Groups of Regulatory Functions. Mol. Cell. Proteomics 11, M111.013565-M111.013565 (2012). WB, Human, Mouse, Rat, Guinea pig, Bovine, Dog, Horse, Rabbit 22219345

Gene Symbol ATL3
Official Gene Full Name Atlastin GTPase 3
Alias Symbols ATL3, DKFZP564J0863
NCBI Gene Id 25923
Protein Name Atlastin-3
Description of Target DKFZP564J0863(ATL3, atlastin GTPase 3) belongs to the GBP family.In the family of human GTPases, atlastin-2 and -3 are closely related to atlastin-1.
Swissprot Id Q6DD88
Protein Accession # NP_056274
Nucleotide Accession # NM_015459
Protein Size (# AA) 541
Molecular Weight 60kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express DKFZP564J0863.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express DKFZP564J0863.
Protein Interactions UBC; SUMO1; NEDD8; RNF2; env; APP;
  1. What is the species homology for "DKFZP564J0863 Antibody - middle region : HRP (ARP47163_P050-HRP)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat".

  2. How long will it take to receive "DKFZP564J0863 Antibody - middle region : HRP (ARP47163_P050-HRP)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "DKFZP564J0863 Antibody - middle region : HRP (ARP47163_P050-HRP)" provided in?

    This item is provided in "Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.".
    Additional format options may be available. For more information please contact

  4. What are other names for "DKFZP564J0863 Antibody - middle region : HRP (ARP47163_P050-HRP)"?

    This target may also be called "ATL3, DKFZP564J0863" in publications.

  5. What is the shipping cost for "DKFZP564J0863 Antibody - middle region : HRP (ARP47163_P050-HRP)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "DKFZP564J0863 Antibody - middle region : HRP (ARP47163_P050-HRP)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "DKFZP564J0863 Antibody - middle region : HRP (ARP47163_P050-HRP)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "60kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "DKFZP564J0863 Antibody - middle region : HRP (ARP47163_P050-HRP)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "ATL3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ATL3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ATL3"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ATL3"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ATL3"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ATL3"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:DKFZP564J0863 Antibody - middle region : HRP (ARP47163_P050-HRP)
Your Rating
We found other products you might like!