Search Antibody, Protein, and ELISA Kit Solutions

DKFZP564J0863 Antibody - middle region : HRP (ARP47163_P050-HRP)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP47163_P050 Unconjugated

ARP47163_P050-FITC Conjugated

ARP47163_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format:
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Clonality:
Polyclonal
Host:
Rabbit
Conjugation:
HRP
Application:
WB
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human DKFZP564J0863
Purification:
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Complete computational species homology data:
Anti-DKFZP564J0863 (ARP47163_P050)
Peptide Sequence:
Synthetic peptide located within the following region: DHFKKTKKMGGKDFSFRYQQELEEEIKELYENFCKHNGSKNVFSTFRTPA
Concentration:
0.5 mg/ml
Blocking Peptide:
For anti-ATL3 (ARP47163_P050-HRP) antibody is Catalog # AAP47163 (Previous Catalog # AAPP27936)
Datasheets/Manuals:
Printable datasheet for anti-ATL3 (ARP47163_P050-HRP) antibody
Target Reference:
Dias (2000) Proc. Natl. Acad. Sci. U.S.A. 97 (7), 3491-3496
Publications:

Polisetty, R. V. et al. LC-MS/MS Analysis of Differentially Expressed Glioblastoma Membrane Proteome Reveals Altered Calcium Signaling and Other Protein Groups of Regulatory Functions. Mol. Cell. Proteomics 11, M111.013565-M111.013565 (2012). WB, Human, Mouse, Rat, Guinea pig, Bovine, Dog, Horse, Rabbit 22219345

Gene Symbol:
ATL3
Official Gene Full Name:
Atlastin GTPase 3
Alias Symbols:
ATL3, DKFZP564J0863
NCBI Gene Id:
25923
Protein Name:
Atlastin-3
Description of Target:
DKFZP564J0863(ATL3, atlastin GTPase 3) belongs to the GBP family.In the family of human GTPases, atlastin-2 and -3 are closely related to atlastin-1.
Swissprot Id:
Q6DD88
Protein Accession #:
NP_056274
Nucleotide Accession #:
NM_015459
Protein Size (# AA):
541
Molecular Weight:
60kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express DKFZP564J0863.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express DKFZP564J0863.
Protein Interactions:
UBC; SUMO1; NEDD8; RNF2; env; APP;

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...