Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
SKU
ARP47163_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP47163_P050-FITC Conjugated

ARP47163_P050-HRP Conjugated

ARP47163_P050-Biotin Conjugated

DKFZP564J0863 Antibody - middle region (ARP47163_P050)

Catalog#: ARP47163_P050
Domestic: within 1-2 days delivery International: 1-2 days
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human DKFZP564J0863
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Complete computational species homology data Anti-DKFZP564J0863 (ARP47163_P050)
Peptide Sequence Synthetic peptide located within the following region: DHFKKTKKMGGKDFSFRYQQELEEEIKELYENFCKHNGSKNVFSTFRTPA
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-ATL3 (ARP47163_P050) antibody is Catalog # AAP47163 (Previous Catalog # AAPP27936)
Datasheets/Manuals Printable datasheet for anti-ATL3 (ARP47163_P050) antibody
Target Reference Dias (2000) Proc. Natl. Acad. Sci. U.S.A. 97 (7), 3491-3496
Publications

Polisetty, R. V. et al. LC-MS/MS Analysis of Differentially Expressed Glioblastoma Membrane Proteome Reveals Altered Calcium Signaling and Other Protein Groups of Regulatory Functions. Mol. Cell. Proteomics 11, M111.013565-M111.013565 (2012). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 22219345

Gene Symbol ATL3
Official Gene Full Name Atlastin GTPase 3
Alias Symbols ATL3, DKFZP564J0863
NCBI Gene Id 25923
Protein Name Atlastin-3
Description of Target DKFZP564J0863(ATL3, atlastin GTPase 3) belongs to the GBP family.In the family of human GTPases, atlastin-2 and -3 are closely related to atlastin-1.
Swissprot Id Q6DD88
Protein Accession # NP_056274
Nucleotide Accession # NM_015459
Protein Size (# AA) 541
Molecular Weight 60kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express DKFZP564J0863.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express DKFZP564J0863.
Protein Interactions UBC; SUMO1; NEDD8; RNF2; env; APP;
Write Your Own Review
You're reviewing:DKFZP564J0863 Antibody - middle region (ARP47163_P050)
Your Rating