DKFZP564J0863 Antibody - middle region (ARP47163_P050)

Size:100 ul

Click here to learn more about Aviva's By-Request Conjugation Service.

Human HCT15

Basic Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human DKFZP564J0863
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
• Complete computational species homology data: Anti-DKFZP564J0863 (ARP47163_P050)
• Peptide Sequence: Synthetic peptide located within the following region: DHFKKTKKMGGKDFSFRYQQELEEEIKELYENFCKHNGSKNVFSTFRTPA
• Concentration: Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
• Blocking Peptide: For anti-ATL3 (ARP47163_P050) antibody is Catalog # AAP47163 (Previous Catalog # AAPP27936)
• Datasheets/Manuals: Printable datasheet for anti-ATL3 (ARP47163_P050) antibody
• Target Reference: Dias (2000) Proc. Natl. Acad. Sci. U.S.A. 97 (7), 3491-3496
• Publications:

  Polisetty, R. V. et al. LC-MS/MS Analysis of Differentially Expressed Glioblastoma Membrane Proteome Reveals Altered Calcium Signaling and Other Protein Groups of Regulatory Functions. Mol. Cell. Proteomics 11, M111.013565-M111.013565 (2012). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 22219345

Target Info

• Gene Symbol: ATL3
• Official Gene Full Name: Atlastin GTPase 3
• Alias Symbols: ATL3, DKFZP564J0863
• NCBI Gene Id: 25923
• Protein Name: Atlastin-3
• Description of Target: DKFZP564J0863(ATL3, atlastin GTPase 3) belongs to the GBP family.In the family of human GTPases, atlastin-2 and -3 are closely related to atlastin-1.
• Swissprot Id: Q6DD88
• Protein Accession #: NP_056274
• Nucleotide Accession #: NM_015459
• Protein Size (# AA): 541
• Molecular Weight: 60kDa
• Tissue Tool: Find tissues and cell lines supported by DNA array analysis to express DKFZP564J0863.
• RNA Seq: Find tissues and cell lines supported by RNA-seq analysis to express DKFZP564J0863.
• Protein Interactions: UBC; SUMO1; NEDD8; RNF2; env; APP;