DKFZP564J0863 Antibody - middle region (ARP47163_P050)

Catalog#: ARP47163_P050
Domestic: within 1-2 days delivery International: 1-2 days

Human HCT15

Click here to learn more about Aviva's By-Request Conjugation Service.

Size:	100 ul
Price:	$289.00
Availability: In Stock
Qty:
Request Bulk Order Quote

Aviva's Satisfaction Guarantee

Conjugation Options

ARP47163_P050-FITC Conjugated

ARP47163_P050-HRP Conjugated

ARP47163_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.

Gene Symbol:: ATL3
Official Gene Full Name:: Atlastin GTPase 3
NCBI Gene Id:: 25923
Protein Name:: Atlastin-3
Swissprot Id:: Q6DD88
Protein Accession #:: NP_056274
Nucleotide Accession #:: NM_015459
Alias Symbols:: ATL3, DKFZP564J0863
Description of Target:: DKFZP564J0863(ATL3, atlastin GTPase 3) belongs to the GBP family.In the family of human GTPases, atlastin-2 and -3 are closely related to atlastin-1.
Protein Size (# AA):: 541
Molecular Weight:: 60kDa
Host:: Rabbit
Clonality:: Polyclonal
Purification:: Affinity Purified
Application:: WB
Tissue Tool:: Find tissues and cell lines supported by DNA array analysis to express DKFZP564J0863.
RNA Seq:: Find tissues and cell lines supported by RNA-seq analysis to express DKFZP564J0863.
Immunogen:: The immunogen is a synthetic peptide directed towards the middle region of human DKFZP564J0863
Predicted Species Reactivity:: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Tested Species Reactivity:: Human
Predicted Homology Based on Immunogen Sequence:: Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Complete computational species homology data:: Anti-DKFZP564J0863 (ARP47163_P050)
Peptide Sequence:: Synthetic peptide located within the following region: DHFKKTKKMGGKDFSFRYQQELEEEIKELYENFCKHNGSKNVFSTFRTPA
Product Format:: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:: Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:: UBC; SUMO1; NEDD8; RNF2; env; APP;
Blocking Peptide:: For anti-ATL3 (ARP47163_P050) antibody is Catalog # AAP47163 (Previous Catalog # AAPP27936)
Datasheets/Manuals:: Printable datasheet for anti-ATL3 (ARP47163_P050) antibody

Target Reference:: Dias (2000) Proc. Natl. Acad. Sci. U.S.A. 97 (7), 3491-3496
Publications:: Polisetty, R. V. et al. LC-MS/MS Analysis of Differentially Expressed Glioblastoma Membrane Proteome Reveals Altered Calcium Signaling and Other Protein Groups of Regulatory Functions. Mol. Cell. Proteomics 11, M111.013565-M111.013565 (2012). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 22219345