- Gene Symbol:
- ATL3
- NCBI Gene Id:
- 25923
- Official Gene Full Name:
- Atlastin GTPase 3
- Protein Name:
- Atlastin-3
- Swissprot Id:
- Q6DD88
- Protein Accession #:
- NP_056274
- Nucleotide Accession #:
- NM_015459
- Alias Symbols:
- ATL3, DKFZP564J0863
- Description of Target:
- DKFZP564J0863(ATL3, atlastin GTPase 3) belongs to the GBP family.In the family of human GTPases, atlastin-2 and -3 are closely related to atlastin-1.
- Protein Size (# AA):
- 541
- Molecular Weight:
- 60kDa
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Purification:
- Affinity Purified
- Application:
- WB
- Tissue Tool:
- Find tissues and cell lines supported by DNA array analysis to express DKFZP564J0863.
- RNA Seq:
- Find tissues and cell lines supported by RNA-seq analysis to express DKFZP564J0863.
- Immunogen:
- The immunogen is a synthetic peptide directed towards the middle region of human DKFZP564J0863
- Tested Species Reactivity:
- Human
- Predicted Homology Based on Immunogen Sequence:
- Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
- Complete computational species homology data:
- Anti-DKFZP564J0863 (ARP47163_P050)
- Peptide Sequence:
- Synthetic peptide located within the following region: DHFKKTKKMGGKDFSFRYQQELEEEIKELYENFCKHNGSKNVFSTFRTPA
- Product Format:
- Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
- Reconstitution and Storage:
- For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
- Concentration:
- Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
- Protein Interactions:
- UBC; SUMO1; NEDD8; RNF2; env; APP;
- Blocking Peptide:
- For anti-ATL3 (ARP47163_P050) antibody is Catalog # AAP47163 (Previous Catalog # AAPP27936)
- Datasheets/Manuals:
- Printable datasheet for anti-ATL3 (ARP47163_P050) antibody
- Target Reference:
- Dias (2000) Proc. Natl. Acad. Sci. U.S.A. 97 (7), 3491-3496
- Publications:
Polisetty, R. V. et al. LC-MS/MS Analysis of Differentially Expressed Glioblastoma Membrane Proteome Reveals Altered Calcium Signaling and Other Protein Groups of Regulatory Functions. Mol. Cell. Proteomics 11, M111.013565-M111.013565 (2012). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 22219345
Product Reviews
- Protocol:
- Tips Information:
See our General FAQ page.
