Catalog No: ARP50142_P050
Price: $0.00
SKU
ARP50142_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-DISP1 (ARP50142_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Horse, Pig, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human DISP1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceHorse: 93%; Human: 100%; Mouse: 93%; Pig: 86%; Rabbit: 100%; Rat: 86%; Zebrafish: 79%
Complete computational species homology dataAnti-DISP1 (ARP50142_P050)
Peptide SequenceSynthetic peptide located within the following region: FVLCDVWNYTKFDKPHAETSETVSITLQHAALSMFVTSFTTAAAFYANYV
Concentration0.5 mg/ml
Blocking PeptideFor anti-DISP1 (ARP50142_P050) antibody is Catalog # AAP50142 (Previous Catalog # AAPS28508)
ReferenceMa,Y., (2002) Cell 111 (1), 63-75
Gene SymbolDISP1
Gene Full NameDispatched homolog 1 (Drosophila)
Alias SymbolsDISPA
NCBI Gene Id84976
Protein NameProtein dispatched homolog 1
Description of TargetDISP1 functions in hedgehog (Hh) signaling. Regulates the release and extracellular accumulation of cholesterol-modified hedgehog proteins and is hence required for effective production of the Hh signal.The pattern of cellular proliferation and differentiation that leads to normal development of embryonic structures often depends upon the localized production of secreted protein signals. Cells surrounding the source of a particular signal respond in a graded manner according to the effective concentration of the signal, and this response produces the pattern of cell types constituting the mature structure. A novel segment-polarity gene known as dispatched has been identified in Drosophila and its protein product is required for normal Hedgehog (Hh) signaling. This gene is one of two human homologs of Drosophila dispatched and, based on sequence identity to its mouse counterpart, the encoded protein may play an essential role in Hh patterning activities in the early embryo.
Swissprot IdQ96F81
Protein Accession #NP_116279
Nucleotide Accession #NM_032890
Protein Size (# AA)1524
Molecular Weight171 kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express DISP1.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express DISP1.
Protein InteractionsLAPTM5; UBC;
  1. What is the species homology for "DISP1 Antibody - middle region (ARP50142_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Horse, Pig, Rabbit, Zebrafish".

  2. How long will it take to receive "DISP1 Antibody - middle region (ARP50142_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "DISP1 Antibody - middle region (ARP50142_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "DISP1 Antibody - middle region (ARP50142_P050)"?

    This target may also be called "DISPA" in publications.

  5. What is the shipping cost for "DISP1 Antibody - middle region (ARP50142_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "DISP1 Antibody - middle region (ARP50142_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "DISP1 Antibody - middle region (ARP50142_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "171 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "DISP1 Antibody - middle region (ARP50142_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "DISP1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "DISP1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "DISP1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "DISP1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "DISP1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "DISP1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:DISP1 Antibody - middle region (ARP50142_P050)
Your Rating