Disintegrin halysin Recombinant Protein (Mamushi) (OPCA03228)

Catalog No: OPCA03228

Disintegrin halysin Recombinant Protein (Gloydius blomhoffii) (OPCA03228) in SDS-PAGE showing the molecular weight of approximately 9.52 kDa.

Product Info

• Predicted Species Reactivity: Gloydius blomhoffii
• Product Format: Liquid or Lyophilized powder
• Host: Gloydius blomhoffii
• Additional Information: Relevance: Inhibits fibrinogen interaction with platelets. Acts by binding to alpha-IIb/beta-3 (ITGA2B/ITGB3) on the platelet surface and inhibits aggregation induced by ADP, thrombin, platelet-activating factor and collagen.
• Reconstitution and Storage: -20°C or -80°C
• Formulation: 20 mM Tris-HCl based buffer, pH 8.0
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: EAGEECDCGSPGNPCCDAATCKLRQGAQCAEGLCCDQCRFMKKGTVCRIARGDDMDDYCNGISAGCPRNPF
• Protein Sequence: EAGEECDCGSPGNPCCDAATCKLRQGAQCAEGLCCDQCRFMKKGTVCRIARGDDMDDYCNGISAGCPRNPF
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Yeast
• Protein Range: 1-71 aa
• Tag: N-terminal 6xHis-tagged

Target Info

• Reference: Halysin, an antiplatelet Arg-Gly-Asp-containing snake venom peptide, as fibrinogen receptor antagonist.Huang T.-F., Liu C.-S., Ouyang C.H., Teng C.-M.Biochem. Pharmacol. 42:1209-1219(1991)
• Alias Symbols: Platelet aggregation activation inhibitor.
• Protein Name: Disintegrin halysin
• Description of Target: Inhibits fibrinogen interaction with platelets. Acts by binding to alpha-IIb/beta-3 (ITGA2B/ITGB3) on the platelet surface and inhibits aggregation induced by ADP, thrombin, platelet-activating factor and collagen.
• Uniprot ID: P21858
• Protein Size (# AA): Recombinant
• Molecular Weight: 9.5 kDa