DIAPH3 Antibody - N-terminal region : FITC (ARP65653_P050-FITC)

Catalog No: ARP65653_P050-FITC

Size:100ul

Product Info

• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: FITC: Fluorescein Isothiocyanate
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human DIAPH3
• Purification: Affinity Purified
• Peptide Sequence: Synthetic peptide located within the following region: ILEEVLEALTSAGEEKKIDRFFCIVEGLRHNSVQLQVACMQLINALVTSP
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-DIAPH3 (ARP65653_P050-FITC) antibody is Catalog # AAP65653

Target Info

• Gene Symbol: DIAPH3
• Alias Symbols: AN, DIA2, DRF3, AUNA1, NSDAN, diap3, mDia2
• NCBI Gene Id: 81624
• Description of Target: This gene encodes a member of the diaphanous subfamily of the formin family. Members of this family are involved in actin remodeling and regulate cell movement and adhesion. Mutations in this gene are associated with autosomal dominant auditory neuropathy 1. Multiple transcript variants encoding different isoforms have been found for this gene.
• Uniprot ID: Q9NSV4-7
• Protein Size (# AA): 1112
• Molecular Weight: 122kDa
• Protein Interactions: UBC; WWOX; Dlg4; RAC1; SMAD9; CENPA; CDC42; RHOA; VCP; UBD; SUMO2; SIRT1; HDAC6; NCKIPSD;