Size:100 ul
$289.00
In stock
SKU
ARP36343_P050-HRP
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP36343_P050 Unconjugated

ARP36343_P050-FITC Conjugated

ARP36343_P050-Biotin Conjugated

DHX9 Antibody - N-terminal region : HRP (ARP36343_P050-HRP)

Catalog#: ARP36343_P050-HRP
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Predicted Species Reactivity Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Product Format Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Clonality Polyclonal
Host Rabbit
Conjugation HRP
Application IHC, WB
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Replacement Item This antibody may replace item sc-137183 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human DHX9
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data Anti-DHX9 (ARP36343_P050)
Peptide Sequence Synthetic peptide located within the following region: GLHGNWTLENAKARLNQYFQKEKIQGEYKYTQVGPDHNRSFIAEMTIYIK
Concentration 0.5 mg/ml
Blocking Peptide For anti-DHX9 (ARP36343_P050-HRP) antibody is Catalog # AAP36343 (Previous Catalog # AAPP08650)
Datasheets/Manuals Printable datasheet for anti-DHX9 (ARP36343_P050-HRP) antibody
Target Reference Aratani,S., (2006) Biochem. Biophys. Res. Commun. 340 (1), 125-133
Publications

Kawai, S. & Amano, A. BRCA1 regulates microRNA biogenesis via the DROSHA microprocessor complex. J. Cell Biol. 197, 201-8 (2012). ICC/IF, IP, Rat, Dog, Mouse, Horse, Rabbit, Bovine, Pig, Human 22492723

Gene Symbol DHX9
Official Gene Full Name DEAH (Asp-Glu-Ala-His) box polypeptide 9
Alias Symbols DDX9, LKP, NDH II, NDHII, RHA, NDH2
NCBI Gene Id 1660
Protein Name ATP-dependent RNA helicase A
Description of Target DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DHX9 is a DEAD box protein with RNA helicase activity. It may participate in melting of DNA:RNA hybrids, such as those that occur during transcription, and may play a role in X-linked gene expression.DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein with RNA helicase activity. It may participate in melting of DNA:RNA hybrids, such as those that occur during transcription, and may play a role in X-linked gene expression. It contains 2 copies of a double-stranded RNA-binding domain, a DEXH core domain and an RGG box. The RNA-binding domains and RGG box influence and regulate RNA helicase activity.
Swissprot Id Q08211
Protein Accession # NP_001348
Nucleotide Accession # NM_001357
Protein Size (# AA) 1279
Molecular Weight 141kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express DHX9.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express DHX9.
Protein Interactions UBC; PA2G4; FBXW11; AURKA; SUMO2; SUMO3; MDM2; CEP250; SART3; STAU1; IVNS1ABP; EIF2AK2; LGR4; SUMO1; WWOX; RPA3; RPA2; RPA1; SUZ12; EED; EZH2; RNF2; rev; DDX1; APBB1; ABCF1; FLII; PRPF40A; C14orf166; RTCB; RPL26L1; NELFB; HNRNPA0; IGF2BP3; LRRFIP1; MAP7;
Write Your Own Review
You're reviewing:DHX9 Antibody - N-terminal region : HRP (ARP36343_P050-HRP)
Your Rating