Size:100 ul
In Stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP36343_P050 Unconjugated

ARP36343_P050-HRP Conjugated

ARP36343_P050-Biotin Conjugated

DHX9 Antibody - N-terminal region : FITC (ARP36343_P050-FITC)

Catalog#: ARP36343_P050-FITC
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Predicted Species Reactivity Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Clonality Polyclonal
Host Rabbit
Conjugation FITC (FAM): Excitation 495 nm/ Emission 520 nm
Application IHC, WB
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Replacement Item This antibody may replace item sc-137183 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human DHX9
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data Anti-DHX9 (ARP36343_P050)
Peptide Sequence Synthetic peptide located within the following region: GLHGNWTLENAKARLNQYFQKEKIQGEYKYTQVGPDHNRSFIAEMTIYIK
Concentration 0.5 mg/ml
Blocking Peptide For anti-DHX9 (ARP36343_P050-FITC) antibody is Catalog # AAP36343 (Previous Catalog # AAPP08650)
Datasheets/Manuals Printable datasheet for anti-DHX9 (ARP36343_P050-FITC) antibody
Target Reference Aratani,S., (2006) Biochem. Biophys. Res. Commun. 340 (1), 125-133

Kawai, S. & Amano, A. BRCA1 regulates microRNA biogenesis via the DROSHA microprocessor complex. J. Cell Biol. 197, 201-8 (2012). ICC/IF, IP, Rat, Dog, Mouse, Horse, Rabbit, Bovine, Pig, Human 22492723

Gene Symbol DHX9
Official Gene Full Name DEAH (Asp-Glu-Ala-His) box polypeptide 9
Alias Symbols DDX9, LKP, NDH II, NDHII, RHA, NDH2
NCBI Gene Id 1660
Protein Name ATP-dependent RNA helicase A
Description of Target DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DHX9 is a DEAD box protein with RNA helicase activity. It may participate in melting of DNA:RNA hybrids, such as those that occur during transcription, and may play a role in X-linked gene expression.DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein with RNA helicase activity. It may participate in melting of DNA:RNA hybrids, such as those that occur during transcription, and may play a role in X-linked gene expression. It contains 2 copies of a double-stranded RNA-binding domain, a DEXH core domain and an RGG box. The RNA-binding domains and RGG box influence and regulate RNA helicase activity.
Swissprot Id Q08211
Protein Accession # NP_001348
Nucleotide Accession # NM_001357
Protein Size (# AA) 1279
Molecular Weight 141kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express DHX9.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express DHX9.
Protein Interactions UBC; PA2G4; FBXW11; AURKA; SUMO2; SUMO3; MDM2; CEP250; SART3; STAU1; IVNS1ABP; EIF2AK2; LGR4; SUMO1; WWOX; RPA3; RPA2; RPA1; SUZ12; EED; EZH2; RNF2; rev; DDX1; APBB1; ABCF1; FLII; PRPF40A; C14orf166; RTCB; RPL26L1; NELFB; HNRNPA0; IGF2BP3; LRRFIP1; MAP7;
  1. What is the species homology for "DHX9 Antibody - N-terminal region : FITC (ARP36343_P050-FITC)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat".

  2. How long will it take to receive "DHX9 Antibody - N-terminal region : FITC (ARP36343_P050-FITC)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "DHX9 Antibody - N-terminal region : FITC (ARP36343_P050-FITC)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact

  4. What are other names for "DHX9 Antibody - N-terminal region : FITC (ARP36343_P050-FITC)"?

    This target may also be called "DDX9, LKP, NDH II, NDHII, RHA, NDH2" in publications.

  5. What is the shipping cost for "DHX9 Antibody - N-terminal region : FITC (ARP36343_P050-FITC)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "DHX9 Antibody - N-terminal region : FITC (ARP36343_P050-FITC)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "DHX9 Antibody - N-terminal region : FITC (ARP36343_P050-FITC)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "141kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "DHX9 Antibody - N-terminal region : FITC (ARP36343_P050-FITC)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "DHX9"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "DHX9"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "DHX9"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "DHX9"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "DHX9"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "DHX9"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:DHX9 Antibody - N-terminal region : FITC (ARP36343_P050-FITC)
Your Rating