DHX9 Antibody - N-terminal region (ARP36343_P050)

Catalog#: ARP36343_P050

• Size: 100 ul

• Gene Symbol: DHX9
• Official Gene Full Name: DEAH (Asp-Glu-Ala-His) box polypeptide 9
• NCBI Gene Id: 1660
• Protein Name: ATP-dependent RNA helicase A
• Swissprot Id: Q08211
• Protein Accession #: NP_001348
• Nucleotide Accession #: NM_001357
• Alias Symbols: DDX9, LKP, NDH II, NDHII, RHA, NDH2
• Replacement Item: This antibody may replace item sc-137183 from Santa Cruz Biotechnology.
• Description of Target: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DHX9 is a DEAD box protein with RNA helicase activity. It may participate in melting of DNA:RNA hybrids, such as those that occur during transcription, and may play a role in X-linked gene expression.DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein with RNA helicase activity. It may participate in melting of DNA:RNA hybrids, such as those that occur during transcription, and may play a role in X-linked gene expression. It contains 2 copies of a double-stranded RNA-binding domain, a DEXH core domain and an RGG box. The RNA-binding domains and RGG box influence and regulate RNA helicase activity.
• Protein Size (# AA): 1279
• Molecular Weight: 141kDa
• Host: Rabbit
• Clonality: Polyclonal
• Purification: Affinity Purified
• Application: IHC, WB, IP
• RNA Seq: Find tissues and cell lines supported by RNA-seq analysis to express DHX9.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human DHX9
• Predicted Species Reactivity: Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
• Tested Species Reactivity: Human
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: GLHGNWTLENAKARLNQYFQKEKIQGEYKYTQVGPDHNRSFIAEMTIYIK
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Concentration: Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
• Protein Interactions: UBC; PA2G4; FBXW11; AURKA; SUMO2; SUMO3; MDM2; CEP250; SART3; STAU1; IVNS1ABP; EIF2AK2; LGR4; SUMO1; WWOX; RPA3; RPA2; RPA1; SUZ12; EED; EZH2; RNF2; rev; DDX1; APBB1; ABCF1; FLII; PRPF40A; C14orf166; RTCB; RPL26L1; NELFB; HNRNPA0; IGF2BP3; LRRFIP1; MAP7;
• Blocking Peptide: For anti-DHX9 (ARP36343_P050) antibody is Catalog # AAP36343 (Previous Catalog # AAPP08650)
• Target Reference: Aratani,S., (2006) Biochem. Biophys. Res. Commun. 340 (1), 125-133
• Publications:

  Kawai, S. & Amano, A. BRCA1 regulates microRNA biogenesis via the DROSHA microprocessor complex. J. Cell Biol. 197, 201-8 (2012). IHC, WB, Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat 22492723

Protocol:

• Reconstitution Instructions
• Immunohistochemistry (IHC) Protocol
• Immunocytochemistry (ICC) Protocol
• Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
• Western Blotting/Immunoblotting (WB/IB) Protocol
• Blocking Peptide Competition Protocol (BPCP)
• Immunoprecipitation (IP) Protocol

Tips Information:

• IHC Tips & Tricks
• ICC Tips & Tricks
• ELISA Tips & Tricks
• WB/IB Tips & Tricks
• IP Tips & Tricks

See our General FAQ page.

Product Protocols: DHX9 antibody tested with Human Transfected 293T Cells (ARP36343_P050)

Product Protocols: DHX9 antibody tested by IHC with human pancreas (ARP36343)