Search Antibody, Protein, and ELISA Kit Solutions

DHX9 Antibody - N-terminal region (ARP36343_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP36343_P050-FITC Conjugated

ARP36343_P050-HRP Conjugated

ARP36343_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
IHC, WB, IP
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-137183 from Santa Cruz Biotechnology.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human DHX9
Purification:
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-DHX9 (ARP36343_P050)
Peptide Sequence:
Synthetic peptide located within the following region: GLHGNWTLENAKARLNQYFQKEKIQGEYKYTQVGPDHNRSFIAEMTIYIK
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-DHX9 (ARP36343_P050) antibody is Catalog # AAP36343 (Previous Catalog # AAPP08650)
Datasheets/Manuals:
Printable datasheet for anti-DHX9 (ARP36343_P050) antibody
Target Reference:
Aratani,S., (2006) Biochem. Biophys. Res. Commun. 340 (1), 125-133
Publications:

Kawai, S. & Amano, A. BRCA1 regulates microRNA biogenesis via the DROSHA microprocessor complex. J. Cell Biol. 197, 201-8 (2012). IHC, WB, Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat 22492723

Gene Symbol:
DHX9
Official Gene Full Name:
DEAH (Asp-Glu-Ala-His) box polypeptide 9
Alias Symbols:
DDX9, LKP, NDH II, NDHII, RHA, NDH2
NCBI Gene Id:
1660
Protein Name:
ATP-dependent RNA helicase A
Description of Target:
DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DHX9 is a DEAD box protein with RNA helicase activity. It may participate in melting of DNA:RNA hybrids, such as those that occur during transcription, and may play a role in X-linked gene expression.DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein with RNA helicase activity. It may participate in melting of DNA:RNA hybrids, such as those that occur during transcription, and may play a role in X-linked gene expression. It contains 2 copies of a double-stranded RNA-binding domain, a DEXH core domain and an RGG box. The RNA-binding domains and RGG box influence and regulate RNA helicase activity.
Swissprot Id:
Q08211
Protein Accession #:
NP_001348
Nucleotide Accession #:
NM_001357
Protein Size (# AA):
1279
Molecular Weight:
141kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express DHX9.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express DHX9.
Protein Interactions:
UBC; PA2G4; FBXW11; AURKA; SUMO2; SUMO3; MDM2; CEP250; SART3; STAU1; IVNS1ABP; EIF2AK2; LGR4; SUMO1; WWOX; RPA3; RPA2; RPA1; SUZ12; EED; EZH2; RNF2; rev; DDX1; APBB1; ABCF1; FLII; PRPF40A; C14orf166; RTCB; RPL26L1; NELFB; HNRNPA0; IGF2BP3; LRRFIP1; MAP7;

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...