DHX9 Antibody - N-terminal region (ARP36343_P050)

Size:100 ul

Transfected 293T

Human Pancreas

HEK293 Whole Cell Lysate

Basic Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB, IP
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Replacement Item: This antibody may replace item sc-137183 from Santa Cruz Biotechnology.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human DHX9
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
• Complete computational species homology data: Anti-DHX9 (ARP36343_P050)
• Peptide Sequence: Synthetic peptide located within the following region: GLHGNWTLENAKARLNQYFQKEKIQGEYKYTQVGPDHNRSFIAEMTIYIK
• Concentration: Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
• Blocking Peptide: For anti-DHX9 (ARP36343_P050) antibody is Catalog # AAP36343 (Previous Catalog # AAPP08650)
• Datasheets/Manuals: Printable datasheet for anti-DHX9 (ARP36343_P050) antibody
• Target Reference: Aratani,S., (2006) Biochem. Biophys. Res. Commun. 340 (1), 125-133
• Publications:

  Kawai, S. & Amano, A. BRCA1 regulates microRNA biogenesis via the DROSHA microprocessor complex. J. Cell Biol. 197, 201-8 (2012). IHC, WB, Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat 22492723

Target Info

• Gene Symbol: DHX9
• Official Gene Full Name: DEAH (Asp-Glu-Ala-His) box polypeptide 9
• Alias Symbols: DDX9, LKP, NDH II, NDHII, RHA, NDH2
• NCBI Gene Id: 1660
• Protein Name: ATP-dependent RNA helicase A
• Description of Target: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DHX9 is a DEAD box protein with RNA helicase activity. It may participate in melting of DNA:RNA hybrids, such as those that occur during transcription, and may play a role in X-linked gene expression.DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein with RNA helicase activity. It may participate in melting of DNA:RNA hybrids, such as those that occur during transcription, and may play a role in X-linked gene expression. It contains 2 copies of a double-stranded RNA-binding domain, a DEXH core domain and an RGG box. The RNA-binding domains and RGG box influence and regulate RNA helicase activity.
• Swissprot Id: Q08211
• Protein Accession #: NP_001348
• Nucleotide Accession #: NM_001357
• Protein Size (# AA): 1279
• Molecular Weight: 141kDa
• Tissue Tool: Find tissues and cell lines supported by DNA array analysis to express DHX9.
• RNA Seq: Find tissues and cell lines supported by RNA-seq analysis to express DHX9.
• Protein Interactions: UBC; PA2G4; FBXW11; AURKA; SUMO2; SUMO3; MDM2; CEP250; SART3; STAU1; IVNS1ABP; EIF2AK2; LGR4; SUMO1; WWOX; RPA3; RPA2; RPA1; SUZ12; EED; EZH2; RNF2; rev; DDX1; APBB1; ABCF1; FLII; PRPF40A; C14orf166; RTCB; RPL26L1; NELFB; HNRNPA0; IGF2BP3; LRRFIP1; MAP7;