Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
SKU
ARP36343_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP36343_P050-FITC Conjugated

ARP36343_P050-HRP Conjugated

ARP36343_P050-Biotin Conjugated

DHX9 Antibody - N-terminal region (ARP36343_P050)

Catalog#: ARP36343_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB, IP
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-137183 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human DHX9
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology dataAnti-DHX9 (ARP36343_P050)
Peptide SequenceSynthetic peptide located within the following region: GLHGNWTLENAKARLNQYFQKEKIQGEYKYTQVGPDHNRSFIAEMTIYIK
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-DHX9 (ARP36343_P050) antibody is Catalog # AAP36343 (Previous Catalog # AAPP08650)
Datasheets/ManualsPrintable datasheet for anti-DHX9 (ARP36343_P050) antibody
Target ReferenceAratani,S., (2006) Biochem. Biophys. Res. Commun. 340 (1), 125-133
Publications

Kawai, S. & Amano, A. BRCA1 regulates microRNA biogenesis via the DROSHA microprocessor complex. J. Cell Biol. 197, 201-8 (2012). IHC, WB, Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat 22492723

Gene SymbolDHX9
Official Gene Full NameDEAH (Asp-Glu-Ala-His) box polypeptide 9
Alias SymbolsDDX9, LKP, NDH II, NDHII, RHA, NDH2
NCBI Gene Id1660
Protein NameATP-dependent RNA helicase A
Description of TargetDEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DHX9 is a DEAD box protein with RNA helicase activity. It may participate in melting of DNA:RNA hybrids, such as those that occur during transcription, and may play a role in X-linked gene expression.DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein with RNA helicase activity. It may participate in melting of DNA:RNA hybrids, such as those that occur during transcription, and may play a role in X-linked gene expression. It contains 2 copies of a double-stranded RNA-binding domain, a DEXH core domain and an RGG box. The RNA-binding domains and RGG box influence and regulate RNA helicase activity.
Swissprot IdQ08211
Protein Accession #NP_001348
Nucleotide Accession #NM_001357
Protein Size (# AA)1279
Molecular Weight141kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express DHX9.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express DHX9.
Protein InteractionsUBC; PA2G4; FBXW11; AURKA; SUMO2; SUMO3; MDM2; CEP250; SART3; STAU1; IVNS1ABP; EIF2AK2; LGR4; SUMO1; WWOX; RPA3; RPA2; RPA1; SUZ12; EED; EZH2; RNF2; rev; DDX1; APBB1; ABCF1; FLII; PRPF40A; C14orf166; RTCB; RPL26L1; NELFB; HNRNPA0; IGF2BP3; LRRFIP1; MAP7;
Write Your Own Review
You're reviewing:DHX9 Antibody - N-terminal region (ARP36343_P050)
Your Rating
Free Microscope
Aviva ChIP Antibodies
Aviva HIS tag Deal
Aviva Tissue Tool