DHX9 Antibody - N-terminal region (ARP36343_P050)

Catalog No: ARP36343_P050

WB Suggested Anti-DHX9 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Transfected 293T

Human Pancreas

DHX9 was immunoprecipitated from 2 mg HEK293 Whole Cell Lysate with ARP36343_P050 with 1:200 dilution. Western blot was performed using ARP36343_P050 at 1/1000 dilution.
Lane 1: Control IP in HEK293 Whole Cell Lysate.
Lane 2: DHX9 IP with ARP36343_P050 in HEK293 Whole Cell Lysate.
Lane 3: Input of HEK293 Whole Cell Lysate.

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB, IP
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human DHX9
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: GLHGNWTLENAKARLNQYFQKEKIQGEYKYTQVGPDHNRSFIAEMTIYIK
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-DHX9 (ARP36343_P050) antibody is Catalog # AAP36343 (Previous Catalog # AAPP08650)
• Reference: Aratani,S., (2006) Biochem. Biophys. Res. Commun. 340 (1), 125-133
• Publications:

  Kawai, S. & Amano, A. BRCA1 regulates microRNA biogenesis via the DROSHA microprocessor complex. J. Cell Biol. 197, 201-8 (2012). 22492723

Target Info

• Gene Symbol: DHX9
• Gene Full Name: DEAH (Asp-Glu-Ala-His) box polypeptide 9
• Alias Symbols: LKP, RHA, DDX9, NDH2, NDHII
• NCBI Gene Id: 1660
• Protein Name: ATP-dependent RNA helicase A
• Description of Target: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DHX9 is a DEAD box protein with RNA helicase activity. It may participate in melting of DNA:RNA hybrids, such as those that occur during transcription, and may play a role in X-linked gene expression.DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein with RNA helicase activity. It may participate in melting of DNA:RNA hybrids, such as those that occur during transcription, and may play a role in X-linked gene expression. It contains 2 copies of a double-stranded RNA-binding domain, a DEXH core domain and an RGG box. The RNA-binding domains and RGG box influence and regulate RNA helicase activity.
• Uniprot ID: Q08211
• Protein Accession #: NP_001348
• Nucleotide Accession #: NM_001357
• Protein Size (# AA): 1279
• Molecular Weight: 141kDa
• Protein Interactions: UBC; PA2G4; FBXW11; AURKA; SUMO2; SUMO3; MDM2; CEP250; SART3; STAU1; IVNS1ABP; EIF2AK2; LGR4; SUMO1; WWOX; RPA3; RPA2; RPA1; SUZ12; EED; EZH2; RNF2; rev; DDX1; APBB1; ABCF1; FLII; PRPF40A; C14orf166; RTCB; RPL26L1; NELFB; HNRNPA0; IGF2BP3; LRRFIP1; MAP7;