Search Antibody, Protein, and ELISA Kit Solutions

DHX16 Antibody - N-terminal region (ARP36356_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP36356_P050-FITC Conjugated

ARP36356_P050-HRP Conjugated

ARP36356_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
DHX16
Official Gene Full Name:
DEAH (Asp-Glu-Ala-His) box polypeptide 16
NCBI Gene Id:
8449
Protein Name:
cDNA FLJ53577, highly similar to pre-mRNA-splicing factor ATP-dependentRNA helicase DHX16 (EC 3.6.1.-) EMBL BAG63940.1
Swissprot Id:
B4DZ28
Protein Accession #:
NP_001157711
Nucleotide Accession #:
NM_001164239
Alias Symbols:
DBP2, DDX16, PRO2014, PRP8, PRPF2, Prp2
Description of Target:
DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein, which is a functional homolog of fission yeast Prp8 protein involved in cell cycle progression. This gene is mapped to the MHC region on chromosome 6p21.3, a region where many malignant, genetic and autoimmune disease genes are linked. Two transcript variants encoding different isoforms have been found for this gene.
Protein Size (# AA):
981
Molecular Weight:
107kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express DHX16.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express DHX16.
Predicted Species Reactivity:
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 83%; Zebrafish: 92%
Complete computational species homology data:
Anti-DHX16 (ARP36356_P050)
Peptide Sequence:
Synthetic peptide located within the following region: RREYLAKREREKLEDLEAELADEEFLFGDVELSRHERQELKYKRRVRDLA
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
NUDCD1; UBC; GPKOW; SF3B2; DHX38; DGCR14; CSNK2A1; XAB2; HELQ; PYROXD1; NAA40; LSM2; MIF4GD; GON4L; WDR44; EHD2; LSM5; LSM6; GCC2; TCEA2; MTR; GSPT1; GABPB1; APP; COIL; SNRNP27; SNRNP40; SIRT7; MEGF10; Bud13; TADA2A; SRRM2; SRRM1;
Blocking Peptide:
For anti-DHX16 (ARP36356_P050) antibody is Catalog # AAP36356
Datasheets/Manuals:
Printable datasheet for anti-DHX16 (ARP36356_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...