Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP36356_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP36356_P050-FITC Conjugated

ARP36356_P050-HRP Conjugated

ARP36356_P050-Biotin Conjugated

DHX16 Antibody - N-terminal region (ARP36356_P050)

Catalog#: ARP36356_P050
Domestic: within 1-2 days delivery | International: 1-2 days
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 83%; Zebrafish: 92%
Complete computational species homology dataAnti-DHX16 (ARP36356_P050)
Peptide SequenceSynthetic peptide located within the following region: RREYLAKREREKLEDLEAELADEEFLFGDVELSRHERQELKYKRRVRDLA
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-DHX16 (ARP36356_P050) antibody is Catalog # AAP36356
Datasheets/ManualsPrintable datasheet for anti-DHX16 (ARP36356_P050) antibody
Gene SymbolDHX16
Official Gene Full NameDEAH (Asp-Glu-Ala-His) box polypeptide 16
Alias SymbolsDBP2, DDX16, PRO2014, PRP8, PRPF2, Prp2
NCBI Gene Id8449
Protein NamecDNA FLJ53577, highly similar to pre-mRNA-splicing factor ATP-dependentRNA helicase DHX16 (EC 3.6.1.-) EMBL BAG63940.1
Description of TargetDEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein, which is a functional homolog of fission yeast Prp8 protein involved in cell cycle progression. This gene is mapped to the MHC region on chromosome 6p21.3, a region where many malignant, genetic and autoimmune disease genes are linked. Two transcript variants encoding different isoforms have been found for this gene.
Swissprot IdB4DZ28
Protein Accession #NP_001157711
Nucleotide Accession #NM_001164239
Protein Size (# AA)981
Molecular Weight107kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express DHX16.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express DHX16.
Protein InteractionsNUDCD1; UBC; GPKOW; SF3B2; DHX38; DGCR14; CSNK2A1; XAB2; HELQ; PYROXD1; NAA40; LSM2; MIF4GD; GON4L; WDR44; EHD2; LSM5; LSM6; GCC2; TCEA2; MTR; GSPT1; GABPB1; APP; COIL; SNRNP27; SNRNP40; SIRT7; MEGF10; Bud13; TADA2A; SRRM2; SRRM1;
Write Your Own Review
You're reviewing:DHX16 Antibody - N-terminal region (ARP36356_P050)
Your Rating
Aviva Validation Data
Free Microscope
Aviva HIS tag Deal
Aviva Tips and Tricks