Aviva Systems Biology office will be closed for Good Friday - April 19, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

DHODH Antibody - C-terminal region (ARP41942_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP41942_P050-FITC Conjugated

ARP41942_P050-HRP Conjugated

ARP41942_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Dihydroorotate dehydrogenase (quinone)
NCBI Gene Id:
Protein Name:
Dihydroorotate dehydrogenase (quinone), mitochondrial
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
DHOdehase, URA1, POADS
Replacement Item:
This antibody may replace item sc-116990 from Santa Cruz Biotechnology.
Description of Target:
DHODH catalyzes the fourth enzymatic step, the ubiquinone-mediated oxidation of dihydroorotate to orotate, in de novo pyrimidine biosynthesis. This protein is a mitochondrial protein located on the outer surface of the inner mitochondrial membrane.The protein encoded by this gene catalyzes the fourth enzymatic step, the ubiquinone-mediated oxidation of dihydroorotate to orotate, in de novo pyrimidine biosynthesis. This protein is a mitochondrial protein located on the outer surface of the inner mitochondrial membrane. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express DHODH.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express DHODH.
The immunogen is a synthetic peptide directed towards the C terminal region of human DHODH
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 91%; Zebrafish: 79%
Complete computational species homology data:
Anti-DHODH (ARP41942_P050)
Peptide Sequence:
Synthetic peptide located within the following region: GGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGAS
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-DHODH (ARP41942_P050) antibody is Catalog # AAP41942 (Previous Catalog # AAPP24479)
Printable datasheet for anti-DHODH (ARP41942_P050) antibody
Sample Type Confirmation:

DHODH is supported by BioGPS gene expression data to be expressed in Jurkat

Target Reference:
Kimura,K., (2006) Genome Res. 16 (1), 55-65

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...