DHDH Antibody - middle region (ARP55066_P050)

Catalog No: ARP55066_P050

WB Suggested Anti-DHDH Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Liver

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Cow, Dog, Horse, Pig, Yeast
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human DHDH
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 92%; Dog: 92%; Horse: 92%; Human: 100%; Pig: 85%; Yeast: 90%
• Peptide Sequence: Synthetic peptide located within the following region: PCWCPTELVVKGEHKEFPLPPVPKDCNFDNGAGMSYEAKHVWECLRKGMK
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-DHDH (ARP55066_P050) antibody is Catalog # AAP55066 (Previous Catalog # AAPP32675)

Target Info

• Reference: Aoki,S., Chem. Biol. Interact. 130-132 (1-3), 775-784 (2001)
• Gene Symbol: DHDH
• Gene Full Name: Dihydrodiol dehydrogenase (dimeric)
• Alias Symbols: 2DD, HUM2DD
• NCBI Gene Id: 27294
• Protein Name: Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase
• Description of Target: DHDH is an enzyme that belongs to the family of dihydrodiol dehydrogenases, which exist in multiple forms in mammalian tissues and are involved in the metabolism of xenobiotics and sugars. These enzymes catalyze the NADP1-linked oxidation of transdihydrodiols of aromatic hydrocarbons to corresponding catechols. This enzyme is a dimeric dihydrodiol dehydrogenase, and it differs from monomeric dihydrodiol dehydrogenases in its high substrate specificity for trans-dihydrodiols of aromatic hydrocarbons in the oxidative direction.This gene encodes an enzyme that belongs to the family of dihydrodiol dehydrogenases, which exist in multiple forms in mammalian tissues and are involved in the metabolism of xenobiotics and sugars. These enzymes catalyze the NADP1-linked oxidation of transdihydrodiols of aromatic hydrocarbons to corresponding catechols. This enzyme is a dimeric dihydrodiol dehydrogenase, and it differs from monomeric dihydrodiol dehydrogenases in its high substrate specificity for trans-dihydrodiols of aromatic hydrocarbons in the oxidative direction.
• Uniprot ID: Q9UQ10
• Protein Accession #: NP_055290
• Nucleotide Accession #: NM_014475
• Protein Size (# AA): 334
• Molecular Weight: 36kDa