Size:100 ul
In Stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP40984_P050 Unconjugated

ARP40984_P050-HRP Conjugated

ARP40984_P050-Biotin Conjugated

DGCR8 Antibody - N-terminal region : FITC (ARP40984_P050-FITC)

Catalog#: ARP40984_P050-FITC
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Clonality Polyclonal
Host Rabbit
Conjugation FITC (FAM): Excitation 495 nm/ Emission 520 nm
Application IHC, WB
Additional Information IHC Information: Paraffin embedded liver tissue, tested with an antibody dilution of 5 ug/ml.
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Replacement Item This antibody may replace item sc-128462 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human DGCR8
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 85%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 77%
Complete computational species homology data Anti-DGCR8 (ARP40984_P050)
Peptide Sequence Synthetic peptide located within the following region: DKKDEENELDQEKRVEYAVLDELEDFTDNLELDEEGAGGFTAKAIVQRDR
Concentration 0.5 mg/ml
Blocking Peptide For anti-DGCR8 (ARP40984_P050-FITC) antibody is Catalog # AAP40984 (Previous Catalog # AAPS02002)
Datasheets/Manuals Printable datasheet for anti-DGCR8 (ARP40984_P050-FITC) antibody
Subunit DGCR8
Target Reference Shiohama,A., (2007) Exp. Cell Res. 313 (20), 4196-4207

Kye, M. J. et al. NMDA mediated contextual conditioning changes miRNA expression. PLoS One 6, e24682 (2011). WB, IHC, Rat, Dog, Pig, Guinea pig, Human, Mouse, Rabbit, Horse, Bovine, Zebrafish 21931811

Van Duyne, R. et al. Localization and sub-cellular shuttling of HTLV-1 tax with the miRNA machinery. PLoS One 7, e40662 (2012). WB, IHC, Rat, Dog, Pig, Guinea pig, Human, Mouse, Rabbit, Horse, Bovine, Zebrafish 22808228

Gene Symbol DGCR8
Official Gene Full Name DiGeorge syndrome critical region gene 8
Alias Symbols C22orf12, DGCRK6, Gy1, pasha
NCBI Gene Id 54487
Protein Name Microprocessor complex subunit DGCR8
Description of Target DGCR8 contains 2 DRBM (double-stranded RNA-binding) domains and 1 WW domain. It may play a part in the etiology of the velocardiofacial/DiGeorge syndrome (VCFS/DGS), a developmental disorder characterized by structural and functional palate anomalies, conotruncal cardiac malformations, immunodeficiency, hypocalcemia, and typical facial anomalies.
Swissprot Id Q8WYQ5
Protein Accession # NP_073557
Nucleotide Accession # NM_022720
Protein Size (# AA) 773
Molecular Weight 85kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express DGCR8.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express DGCR8.
  1. What is the species homology for "DGCR8 Antibody - N-terminal region : FITC (ARP40984_P050-FITC)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish".

  2. How long will it take to receive "DGCR8 Antibody - N-terminal region : FITC (ARP40984_P050-FITC)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "DGCR8 Antibody - N-terminal region : FITC (ARP40984_P050-FITC)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact

  4. What are other names for "DGCR8 Antibody - N-terminal region : FITC (ARP40984_P050-FITC)"?

    This target may also be called "C22orf12, DGCRK6, Gy1, pasha" in publications.

  5. What is the shipping cost for "DGCR8 Antibody - N-terminal region : FITC (ARP40984_P050-FITC)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "DGCR8 Antibody - N-terminal region : FITC (ARP40984_P050-FITC)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "DGCR8 Antibody - N-terminal region : FITC (ARP40984_P050-FITC)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "85kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "DGCR8 Antibody - N-terminal region : FITC (ARP40984_P050-FITC)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "DGCR8"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "DGCR8"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "DGCR8"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "DGCR8"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "DGCR8"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "DGCR8"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:DGCR8 Antibody - N-terminal region : FITC (ARP40984_P050-FITC)
Your Rating
We found other products you might like!