Search Antibody, Protein, and ELISA Kit Solutions

DGCR8 Antibody - N-terminal region : Biotin (ARP40984_P050-Biotin)

100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP40984_P050 Unconjugated

ARP40984_P050-FITC Conjugated

ARP40984_P050-HRP Conjugated

Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Clonality:
Polyclonal
Host:
Rabbit
Conjugation:
Biotin
Application:
IHC, WB
Additional Information:
IHC Information: Paraffin embedded liver tissue, tested with an antibody dilution of 5 ug/ml.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Replacement Item:
This antibody may replace item sc-128462 from Santa Cruz Biotechnology.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human DGCR8
Purification:
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 85%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 77%
Complete computational species homology data:
Anti-DGCR8 (ARP40984_P050)
Peptide Sequence:
Synthetic peptide located within the following region: DKKDEENELDQEKRVEYAVLDELEDFTDNLELDEEGAGGFTAKAIVQRDR
Concentration:
0.5 mg/ml
Blocking Peptide:
For anti-DGCR8 (ARP40984_P050-Biotin) antibody is Catalog # AAP40984 (Previous Catalog # AAPS02002)
Datasheets/Manuals:
Printable datasheet for anti-DGCR8 (ARP40984_P050-Biotin) antibody
Subunit:
DGCR8
Target Reference:
Shiohama,A., (2007) Exp. Cell Res. 313 (20), 4196-4207
Publications:

Kye, M. J. et al. NMDA mediated contextual conditioning changes miRNA expression. PLoS One 6, e24682 (2011). WB, IHC, Rat, Dog, Pig, Guinea pig, Human, Mouse, Rabbit, Horse, Bovine, Zebrafish 21931811

Van Duyne, R. et al. Localization and sub-cellular shuttling of HTLV-1 tax with the miRNA machinery. PLoS One 7, e40662 (2012). WB, IHC, Rat, Dog, Pig, Guinea pig, Human, Mouse, Rabbit, Horse, Bovine, Zebrafish 22808228

Gene Symbol:
DGCR8
Official Gene Full Name:
DiGeorge syndrome critical region gene 8
Alias Symbols:
C22orf12, DGCRK6, Gy1, pasha
NCBI Gene Id:
54487
Protein Name:
Microprocessor complex subunit DGCR8
Description of Target:
DGCR8 contains 2 DRBM (double-stranded RNA-binding) domains and 1 WW domain. It may play a part in the etiology of the velocardiofacial/DiGeorge syndrome (VCFS/DGS), a developmental disorder characterized by structural and functional palate anomalies, conotruncal cardiac malformations, immunodeficiency, hypocalcemia, and typical facial anomalies.
Swissprot Id:
Q8WYQ5
Protein Accession #:
NP_073557
Nucleotide Accession #:
NM_022720
Protein Size (# AA):
773
Molecular Weight:
85kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express DGCR8.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express DGCR8.
Protein Interactions:
MEOX2; PYCRL; DROSHA; RAE1; MAPK1; PRMT1; ERH; CDKN2A; BMI1; SRPK2; SRPK1; CDT1; NAT10; PLEK2; RPRD2; MAPRE2; PRPF4; FLII; APP; CUL3; DDX17; HNRNPR; NCL; ILF3; HSPA8; HSPA5; HNRNPU; HNRNPH1; FUS; DHX9; DDX5;

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...