Size:100 ul
Special Price $229.00 Regular Price $319.00
In stock
SKU
ARP40984_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP40984_P050-FITC Conjugated

ARP40984_P050-HRP Conjugated

ARP40984_P050-Biotin Conjugated

DGCR8 Antibody - N-terminal region (ARP40984_P050)

Catalog#: ARP40984_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Additional Information IHC Information: Paraffin embedded liver tissue, tested with an antibody dilution of 5 ug/ml.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-128462 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human DGCR8
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 85%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 77%
Complete computational species homology data Anti-DGCR8 (ARP40984_P050)
Peptide Sequence Synthetic peptide located within the following region: DKKDEENELDQEKRVEYAVLDELEDFTDNLELDEEGAGGFTAKAIVQRDR
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-DGCR8 (ARP40984_P050) antibody is Catalog # AAP40984 (Previous Catalog # AAPS02002)
Datasheets/Manuals Printable datasheet for anti-DGCR8 (ARP40984_P050) antibody
Subunit DGCR8
Target Reference Shiohama,A., (2007) Exp. Cell Res. 313 (20), 4196-4207
Publications

Belair, CD; Paikari, A; Moltzahn, F; Shenoy, A; Yau, C; Dall'Era, M; Simko, J; Benz, C; Blelloch, R; DGCR8 is essential for tumor progression following PTEN loss in the prostate. 16, 1219-32 (2015). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 26206718

Kye, M. J. et al. NMDA mediated contextual conditioning changes miRNA expression. PLoS One 6, e24682 (2011). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 21931811

Van Duyne, R. et al. Localization and sub-cellular shuttling of HTLV-1 tax with the miRNA machinery. PLoS One 7, e40662 (2012). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 22808228

Gene Symbol DGCR8
Official Gene Full Name DiGeorge syndrome critical region gene 8
Alias Symbols C22orf12, DGCRK6, Gy1, pasha
NCBI Gene Id 54487
Protein Name Microprocessor complex subunit DGCR8
Description of Target DGCR8 contains 2 DRBM (double-stranded RNA-binding) domains and 1 WW domain. It may play a part in the etiology of the velocardiofacial/DiGeorge syndrome (VCFS/DGS), a developmental disorder characterized by structural and functional palate anomalies, conotruncal cardiac malformations, immunodeficiency, hypocalcemia, and typical facial anomalies.
Swissprot Id Q8WYQ5
Protein Accession # NP_073557
Nucleotide Accession # NM_022720
Protein Size (# AA) 773
Molecular Weight 85kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express DGCR8.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express DGCR8.
Protein Interactions MEOX2; PYCRL; DROSHA; RAE1; MAPK1; PRMT1; ERH; CDKN2A; BMI1; SRPK2; SRPK1; CDT1; NAT10; PLEK2; RPRD2; MAPRE2; PRPF4; FLII; APP; CUL3; DDX17; HNRNPR; NCL; ILF3; HSPA8; HSPA5; HNRNPU; HNRNPH1; FUS; DHX9; DDX5;
Write Your Own Review
You're reviewing:DGCR8 Antibody - N-terminal region (ARP40984_P050)
Your Rating