Now Offering Over 102,157 Antibodies & 44,722 Antigens!

DGCR8 antibody - N-terminal region (ARP40984_P050)

100 ul
$319.00
In Stock

Conjugation Options

ARP40984_P050-FITC Conjugated

ARP40984_P050-HRP Conjugated

ARP40984_P050-Biotin Conjugated

Gene Symbol:
DGCR8
NCBI Gene Id:
54487
Official Gene Full Name:
DiGeorge syndrome critical region gene 8
Protein Name:
Microprocessor complex subunit DGCR8
Swissprot Id:
Q8WYQ5
Protein Accession #:
NP_073557
Nucleotide Accession #:
NM_022720
Alias Symbols:
C22orf12, DGCRK6, Gy1, pasha
Replacement Item:
This antibody may replace item sc-128462 from Santa Cruz Biotechnology.
Description of Target:
DGCR8 contains 2 DRBM (double-stranded RNA-binding) domains and 1 WW domain. It may play a part in the etiology of the velocardiofacial/DiGeorge syndrome (VCFS/DGS), a developmental disorder characterized by structural and functional palate anomalies, conotruncal cardiac malformations, immunodeficiency, hypocalcemia, and typical facial anomalies.
Protein Size (# AA):
773
Molecular Weight:
85kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express DGCR8.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express DGCR8.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human DGCR8
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 85%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 77%
Complete computational species homology data:
Anti-DGCR8 (ARP40984_P050)
Peptide Sequence:
Synthetic peptide located within the following region: DKKDEENELDQEKRVEYAVLDELEDFTDNLELDEEGAGGFTAKAIVQRDR
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
MEOX2; PYCRL; DROSHA; RAE1; MAPK1; PRMT1; ERH; CDKN2A; BMI1; SRPK2; SRPK1; CDT1; NAT10; PLEK2; RPRD2; MAPRE2; PRPF4; FLII; APP; CUL3; DDX17; HNRNPR; NCL; ILF3; HSPA8; HSPA5; HNRNPU; HNRNPH1; FUS; DHX9; DDX5;
Blocking Peptide:
For anti-DGCR8 (ARP40984_P050) antibody is Catalog # AAP40984 (Previous Catalog # AAPS02002)
Datasheets/Manuals:
Printable datasheet for anti-DGCR8 (ARP40984_P050) antibody
Subunit:
DGCR8
Additional Information:
IHC Information: Paraffin embedded liver tissue, tested with an antibody dilution of 5 ug/ml.
Target Reference:
Shiohama,A., (2007) Exp. Cell Res. 313 (20), 4196-4207
Publications:

Kye, M. J. et al. NMDA mediated contextual conditioning changes miRNA expression. PLoS One 6, e24682 (2011). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 21931811

Van Duyne, R. et al. Localization and sub-cellular shuttling of HTLV-1 tax with the miRNA machinery. PLoS One 7, e40662 (2012). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 22808228

Belair, CD; Paikari, A; Moltzahn, F; Shenoy, A; Yau, C; Dall'Era, M; Simko, J; Benz, C; Blelloch, R; DGCR8 is essential for tumor progression following PTEN loss in the prostate. 16, 1219-32 (2015). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 26206718

Tell us what you think about this item!

Write A Review
    Please, wait...