SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP52046_P050
Price: $0.00
SKU
ARP52046_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-DFFB (ARP52046_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human DFFB
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceHuman: 100%
Peptide SequenceSynthetic peptide located within the following region: EYFYGLLFTSENLKLVHIVCHKKTTHKLNCDPSRIYKPQTRLKRKQPVRK
Concentration0.5 mg/ml
Blocking PeptideFor anti-DFFB (ARP52046_P050) antibody is Catalog # AAP52046 (Previous Catalog # AAPP30271)
Subunitbeta
ReferenceNeimanis,S., (2007) J. Biol. Chem. 282 (49), 35821-35830
Gene SymbolDFFB
Gene Full NameDNA fragmentation factor, 40kDa, beta polypeptide (caspase-activated DNase)
Alias SymbolsCAD, CPAN, DFF2, DFF40, DFF-40
NCBI Gene Id1677
Protein NameDNA fragmentation factor subunit beta
Description of TargetDFFB is a nuclease that induces DNA fragmentation and chromatin condensation during apoptosis. DFFB degrades naked DNA and induces apoptotic morphology.Apoptosis is a cell death process that removes toxic and/or useless cells during mammalian development. The apoptotic process is accompanied by shrinkage and fragmentation of the cells and nuclei and degradation of the chromosomal DNA into nucleosomal units. DNA fragmentation factor (DFF) is a heterodimeric protein of 40-kD (DFFB) and 45-kD (DFFA) subunits. DFFA is the substrate for caspase-3 and triggers DNA fragmentation during apoptosis. DFF becomes activated when DFFA is cleaved by caspase-3. The cleaved fragments of DFFA dissociate from DFFB, the active component of DFF. DFFB has been found to trigger both DNA fragmentation and chromatin condensation during apoptosis. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene but the biological validity of these variants has not been determined. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Uniprot IDO76075
Protein Accession #NP_004393
Nucleotide Accession #NM_004402
Protein Size (# AA)338
Molecular Weight39kDa
Protein InteractionsDFFA; UBC; NUBP1; MARCKS; APP; CAND1; COPS5; CUL1; CUL2; CUL5; NEDD8; CIDEB; DFFB; TOP2A;
  1. What is the species homology for "DFFB Antibody - middle region (ARP52046_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "DFFB Antibody - middle region (ARP52046_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "DFFB Antibody - middle region (ARP52046_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "DFFB Antibody - middle region (ARP52046_P050)"?

    This target may also be called "CAD, CPAN, DFF2, DFF40, DFF-40" in publications.

  5. What is the shipping cost for "DFFB Antibody - middle region (ARP52046_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "DFFB Antibody - middle region (ARP52046_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "DFFB Antibody - middle region (ARP52046_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "39kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "DFFB Antibody - middle region (ARP52046_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "DFFB"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "DFFB"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "DFFB"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "DFFB"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "DFFB"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "DFFB"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:DFFB Antibody - middle region (ARP52046_P050)
Your Rating
We found other products you might like!