Search Antibody, Protein, and ELISA Kit Solutions

DERL1 Antibody - C-terminal region : FITC (ARP73820_P050-FITC)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP73820_P050 Unconjugated

ARP73820_P050-HRP Conjugated

ARP73820_P050-Biotin Conjugated

Gene Symbol:
DERL1
NCBI Gene Id:
79139
Swissprot Id:
Q9BUN8
Protein Accession #:
NP_077271
Alias Symbols:
DERL1, DER1, UNQ243/PRO276,
Replacement Item:
This antibody may replace item sc-293385 from Santa Cruz Biotechnology.
Description of Target:
The protein encoded by this gene is a member of the derlin family. Members of this family participate in the ER-associated degradation response and retrotranslocate misfolded or unfolded proteins from the ER lumen to the cytosol for proteasomal degradation. This protein recognizes substrate in the ER and works in a complex to retrotranslocate it across the ER membrane into the cytosol. This protein may select cystic fibrosis transmembrane conductance regulator protein (CFTR) for degradation as well as unfolded proteins in Alzheimer's disease. Alternative splicing results in multiple transcript variants that encode different protein isoforms.
Protein Size (# AA):
251
Molecular Weight:
27kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express DERL1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express DERL1.
Immunogen:
The immunogen is a synthetic peptide directed towards the C-terminal region of Human DERL1
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: STPQFLYRWLPSRRGGVSGFGVPPASMRRAADQNGGGGRHNWGQGFRLGD
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
0.5 mg/ml
Protein Interactions:
HM13; TCF25; XBP1; EGFR; USP19; ZFAND2B; Vcp; PTGS2; CAV1; SYVN1; DERL2; SHH; SEL1L; SERPINA1; FAF2; ALB; APP; DERL1; EDEM1; RNF5; RHO; NGLY1; BCAP31; CFTR; UBXN6; TRAM1; APOB; CLN6; UBXN4; ERN1; ASGR2; UBE2J1; ERLIN2; UBC; HLA-A; CACNA1C; YOD1; VIMP; KPN
Blocking Peptide:
For anti-DERL1 (ARP73820_P050-FITC) antibody is Catalog # AAP73820
Datasheets/Manuals:
Printable datasheet for anti-DERL1 (ARP73820_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...