DERF2 Recombinant Protein (American house dust mite) (OPCA03150)

Catalog No: OPCA03150

DERF2 Recombinant Protein (Dermatophagoides farinae) (OPCA03150) in SDS-PAGE showing the molecular weight of approximately 30.07 kDa.

Product Info

• Predicted Species Reactivity: Dermatophagoides farinae
• Product Format: Liquid or Lyophilized powder
• Host: Dermatophagoides farinae
• Reconstitution and Storage: -20°C or -80°C
• Formulation: 20 mM Tris-HCl based buffer, pH 8.0
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: DQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACAIATHGKIRD
• Protein Sequence: DQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACAIATHGKIRD
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: E.coli
• Protein Range: 18-146 aa
• Tag: N-terminal 6xHis-SUMO-tagged

Target Info

• Reference: Cloning and expression of cDNA coding for the major house dust mite allergen Der f II in Escherichia coli.Yuuki T., Okumura Y., Ando T., Yamakawa H., Suko M., Haida M., Okudaira H.Agric. Biol. Chem. 55:1233-1238(1991)
• Gene Symbol: DERF2
• Alias Symbols: Allergen Der f II.
• Protein Name: Mite group 2 allergen Der f 2
• Uniprot ID: Q00855
• Protein Size (# AA): Full Length of Mature Protein
• Molecular Weight: 30.1 kDa